KEGG   Acropora digitifera (stony coral): 107339303
Entry
107339303         CDS       T04352                                 

Definition
(RefSeq) beclin-1-like
  KO
K08334  beclin
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04136  Autophagy - other
adf04137  Mitophagy - animal
adf04140  Autophagy - animal
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107339303
   04136 Autophagy - other
    107339303
   04137 Mitophagy - animal
    107339303
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107339303
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:adf04131]
    107339303
   03029 Mitochondrial biogenesis [BR:adf03029]
    107339303
Membrane trafficking [BR:adf04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    107339303
Mitochondrial biogenesis [BR:adf03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    107339303
SSDB
Motif
Pfam: APG6 APG6_N BH3 ERM SOAR FH2 DUF6481 V_ATPase_I PHM7_cyt YabA AAA_11
Other DBs
NCBI-GeneID: 107339303
NCBI-ProteinID: XP_015760054
LinkDB
Position
Un
AA seq 417 aa
MASGKETRTALVSFVCQRCYQPLRLDMSLLSMDGEALAELAEPFPGFEPDSSGGQDTERH
DTSIHETPTNLEEDDTVVRRKIAPPRLKVTSLLFDIMSGHSSIDHPLCEECTDTLLDQLD
QQLKITDDELKDYNVFFNKLNEKPSVDTDALSKELAELRKEEEELVRQLEEVEKEREKVA
EKMEIENERSKQLAIEEKKYWTEYSEYQKELLEYQDEQQSVENQMRYAQAQLDKLKKTNV
FNSTFHIWHKGHFGTINNFRLGRLPSVPVEWSEINAAWGQTVLLLHSLARKMNLTFERYR
LVPFGNHSYLESLADKSKDLPLXGSFKFPYYRRFDQAMVGFLDCLQQFKEAVEKVDKRFC
LPYRMEKGKIYDTSGSGGAFSIKIQFNSEEQWTKALKFVLTNLKWGLAWVSSQFTDK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcttccgggaaagaaactcgtacagcgcttgttagttttgtatgccaaagatgctac
caacccttgagattagacatgtctttgttgtctatggatggagaagcgctagcagaattg
gcagagcctttcccaggatttgaacctgactctagcggtggacaagatacagagagacac
gatacaagtatacacgagactcctactaatttagaggaagatgatacagttgtgaggaga
aaaatcgcacctccaaggctcaaggttaccagtcttctctttgatattatgtctgggcac
tcgagcattgatcatccattgtgcgaagaatgcaccgacactttgctcgatcaacttgac
cagcaactgaagatcacagatgatgaactcaaggactacaacgttttctttaacaagctc
aacgaaaagccttccgtagatacggatgctttgtccaaagaacttgccgaactcagaaaa
gaggaagaagaattggtgaggcagcttgaagaagttgaaaaagaaagagaaaaagttgca
gagaaaatggaaattgaaaacgagagatccaaacagttggcaattgaagagaaaaaatac
tggacagagtacagcgaatatcagaaagagcttttagaatatcaagatgaacagcaaagt
gttgaaaaccaaatgagatatgcacaagcccagctggacaaactcaaaaagacaaatgtg
tttaatagcacctttcacatatggcataagggccattttggaacaatcaataactttagg
ctaggtcgtcttcccagcgtgccggttgagtggagtgaaattaatgcggcctggggccaa
acagtcctgttgcttcattctctggctcgaaagatgaatctaactttcgaaaggtatcgt
cttgttccctttggcaatcactcttatctagagtctctcgctgacaaatccaaggatctt
ccactttgaggctcttttaaatttccttattatcgtagatttgatcaagcaatggttgga
tttttagactgcttacaacagtttaaagaggcagttgaaaaagttgacaaaagattttgc
cttccatacaggatggaaaagggaaaaatttacgacacgagtggaagcggaggggcgttc
tctataaagatccaattcaattcagaggagcaatggacgaaagcgttaaagttcgtattg
actaacttgaagtggggactggcctgggtctcgtcccagttcacagacaagtga

KEGG   Acropora digitifera (stony coral): 107355806
Entry
107355806         CDS       T04352                                 

Definition
(RefSeq) beclin-1-like
  KO
K08334  beclin
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04136  Autophagy - other
adf04137  Mitophagy - animal
adf04140  Autophagy - animal
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107355806
   04136 Autophagy - other
    107355806
   04137 Mitophagy - animal
    107355806
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107355806
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:adf04131]
    107355806
   03029 Mitochondrial biogenesis [BR:adf03029]
    107355806
Membrane trafficking [BR:adf04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    107355806
Mitochondrial biogenesis [BR:adf03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    107355806
SSDB
Motif
Pfam: APG6 APG6_N ERM SOAR FH2 DUF6481 V_ATPase_I PHM7_cyt FlgN AAA_11 YabA eIF3_N ATG14 Peptidase_S46
Other DBs
NCBI-GeneID: 107355806
NCBI-ProteinID: XP_015777887
LinkDB
Position
Un
AA seq 270 aa
MSGHSSIDHPLCEECTDTLLDQLDQQLKITDDELKDYNVFFNKLNEKPSVDTDALSKELA
ELRKEEEELVRQLEEVEKEREKVAEKMEIENERSKQLAIEEKKYWTEYSEYQKELLEYQD
EQQSVENQMRYAQAQLDKLKKTNVFNSTFHIWHKGHFGTINNFRLGRLPSVPVEWSEINA
AWGQTVLLLHSLARKMNLTFERYRLVPYGNHSYLESLADKSKDLPLYGTGGFRFFWDTKF
DQAMVGFLDCLQQFKEAVEKVDKRFCLPYR
NT seq 813 nt   +upstreamnt  +downstreamnt
atgtctgggcactcgagcattgatcatccattgtgcgaagaatgcaccgacactttgctc
gatcaacttgaccagcaactgaagatcacagatgatgaactcaaggactacaacgttttc
tttaacaagctcaacgaaaagccttccgtagatacggatgctttgtccaaagaacttgcc
gaactcagaaaagaggaagaagaattggtgaggcagcttgaagaagttgaaaaagaaaga
gaaaaagttgcagagaaaatggaaattgaaaacgagagatccaaacagttggcaattgaa
gagaaaaaatactggacagagtacagcgaatatcagaaagagcttttagaatatcaagat
gaacagcaaagtgttgaaaaccaaatgagatatgcacaagcccagctggacaaactcaaa
aagacaaatgtgtttaatagcacctttcacatatggcataagggccattttggaacaatc
aacaactttaggctaggtcgtcttcccagtgtgccggttgagtggagtgaaatcaatgcg
gcctggggccaaacagttctgttgctccattctctcgctcgaaagatgaatctaactttc
gaaaggtatcgtcttgttccctatggcaatcactcttatctagagtctctcgctgacaaa
tccaaggatcttccactatacggaactggaggatttcgattcttttgggacacaaaattt
gatcaagcaatggttggatttttagactgcttacaacagtttaaagaagcagttgaaaaa
gttgacaaaagattttgccttccatacaggtaa

DBGET integrated database retrieval system