KEGG   Acropora digitifera (stony coral): 107348404
Entry
107348404         CDS       T04352                                 

Definition
(RefSeq) serine protease HTRA2, mitochondrial-like
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107348404
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:adf01002]
    107348404
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:adf03110]
    107348404
Enzymes [BR:adf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     107348404
Peptidases and inhibitors [BR:adf01002]
 Serine peptidases
  Family S1: chymotrypsin family
   107348404
Chaperones and folding catalysts [BR:adf03110]
 Other chaperones and cochaperones
  DegP / HtrA
   107348404
SSDB
Motif
Pfam: Trypsin_2 Trypsin PDZ_2 PDZ_6 PDZ Peptidase_S46 Peptidase_S32 Tricorn_PDZ
Other DBs
NCBI-GeneID: 107348404
NCBI-ProteinID: XP_015769931
LinkDB
Position
Un
AA seq 427 aa
MATTLSRRWQKFGQIERLCTRTKTKSKIHVFRMFSTETKKSTQRLPWPWMGSLALGGFLG
YALPKFIGHCKCSGKGETKSIPTGGNESDSSSTPRSARFNFIADAVEKAAPAVVNIEVTG
RHPGFVFGTHTGPTSAGSGFIVTEDGMVLTNAHLVENAMKVSVKLKDGRQFSGIVVDIDL
ENDLATVKLDLNNKTVKFPTLTLGSSSSIRPGEWVVAMGSPLQLSNTITAGIVSTVHRAG
EEIGLPNRGLEYIQTDAAINIGNSGGPLVNLDGDVIGINAITMRFAAGISFSIPIDAAKD
FLSKSIEKVRNGDYRSRNTMRPLAPYQRWYIGITMLTLTPQILNELRRRDQSFHKVEHGV
LVAQINNGSPAQRAGLRSGDIITKINGNKTESSLQVHKAVQKGETLQMELVRGDHTFHLT
FKPEVVG
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggcgaccacgttgtcgagaagatggcaaaaatttggccaaatagaaagactttgtacc
agaacgaaaaccaaaagcaaaattcacgtcttcaggatgttcagtactgaaaccaagaaa
tcgactcaaagattgccctggccttggatgggctctcttgccctaggtggtttcttgggt
tatgcattacctaaattcatcgggcactgcaaatgcagtggaaaaggagagactaaaagc
attcctaccggaggaaatgaatccgattcgagctcaactcctcgatcagctcggtttaat
ttcattgctgatgctgtggagaaagctgcacccgctgttgtgaacattgaggtaacggga
cgacacccgggattcgtgtttggaacacacaccggtccaacaagcgccggctccggattt
atagtcactgaagatggaatggttcttacaaacgcacatttggtggaaaacgcaatgaaa
gtcagtgtgaagttaaaagatggaaggcaatttagcggcatagtggttgatattgatttg
gagaatgacttggcaactgttaaacttgatttaaacaataagaccgtgaagtttcctact
cttactcttgggtcatcctcttcaattcggccaggagagtgggtcgtggcaatgggaagt
cctctacagctgagtaacacaataacagcaggaattgtgagcaccgtgcatcgagctgga
gaggagataggattaccaaacagaggactggaatatatccagacagatgctgctattaat
attggaaactctggaggacctcttgtcaacctggatggtgatgttattggcataaatgca
attaccatgcgttttgcagctggaatttccttttccattccaattgatgctgcaaaggac
tttctttcaaaatcaattgaaaaagtcaggaatggggattatagaagcagaaatacaatg
cggccactggcaccgtaccagcgttggtatattgggattaccatgttaactctaacacca
cagatacttaatgaattaaggagaagggaccaaagttttcacaaagtcgaacacggagtg
cttgttgcacaaataaataatggatcgccagcacaaagagctggccttcgatcaggtgac
atcattaccaaaataaatggcaacaagacagaatcatccttgcaagttcacaaagctgtg
caaaagggggaaacacttcaaatggagcttgtaagaggggaccacacctttcatttaaca
ttcaaaccagaagttgttggttag

DBGET integrated database retrieval system