KEGG   Auricularia subglabra: AURDEDRAFT_145147
Entry
AURDEDRAFT_145147 CDS       T03129                                 
Symbol
HTP8
Name
(GenBank) heme-thiolate peroxidase
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
adl  Auricularia subglabra
Brite
KEGG Orthology (KO) [BR:adl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AURDEDRAFT_145147 (HTP8)
Enzymes [BR:adl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     AURDEDRAFT_145147 (HTP8)
SSDB
Motif
Pfam: Peroxidase_2
Other DBs
NCBI-ProteinID: EJD44057
JGI: 145147
LinkDB
AA seq 376 aa
MLLSNVALGLFAVGASALSIKPYESLAGRSDEEIEAFSHKFPTPGASPPPPAIKNLRQSL
VFDKDHPYIAPRPGDARGPCPGMNTLANHGWLPRSGVATPQQIITASEKGFNMGHNLATF
VTFANMLVNGNHLTNLMSIGTLTPLTGPAPPKPALAGGLSTHNTFEGDASMTRLDAHFGS
NVDFNENLFQQFVNISNEFGGGIFNETAAAEVRYRRIVQSNETNPEFYFEVPRFPIAYAE
AAFAIVFFVDGRKNDKNLDLKTARRFLEANKFPDGFHRRDGGFFIEDLDVVLNSLIGAHP
VLPGSNVQNPDGTFHWVDKSETLTKYADTNCAVYEAFVNKTIAQYPNPKGALRKALNGNL
KNIISPLNCTALKPYP
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgttgctttccaacgttgctctcggtctcttcgccgttggtgcgtccgcgctgagcatc
aagccatatgagtcgctcgccggccgctccgacgaggagatcgaggctttctcccacaag
ttccccaccccgggcgcgagccccccgccgccggccattaagaacttgcgccaaagtttg
gtgttcgacaaggaccacccgtacatcgccccccggcccggagacgctagaggaccgtgc
cctggcatgaacacccttgcgaaccatggttggctgccgcgctcgggtgttgccactccg
caacaaatcatcactgcgtcggagaagggcttcaacatgggccataacttggctactttc
gtcactttcgcgaacatgcttgtaaacgggaaccacctgaccaacctcatgagcatcggc
accctgacgcctctcacgggcccagcgccgccgaagccagcattggcaggcggtctcagc
acccacaacacctttgaaggcgatgcgagcatgacgagactcgacgctcatttcgggtcc
aacgtcgacttcaacgagaatctgttccagcagttcgtgaacatcagcaacgagttcggc
ggcggcatcttcaacgagactgccgcagcggaagttcgctacaggcgcatcgtccagtcg
aacgagaccaacccggagttctacttcgaggtgccgcgcttcccgattgcttacgcggag
gccgcattcgcgatcgtcttcttcgtcgacggccgcaagaacgacaagaacctcgacctg
aagacggcacgccggttcctcgaggcgaacaagttccccgacggcttccaccgccgcgac
ggcggcttcttcatcgaggacctcgacgtcgtgctcaacagcctgatcggcgcgcacccc
gtcctccccggatccaacgttcagaacccggacggcacgttccactgggtcgacaagtcg
gaaacgctcaccaagtatgccgacacgaactgcgccgtgtatgaggccttcgtcaacaag
acgatcgcgcagtacccgaaccccaagggcgccctccgcaaggcgctgaacgggaacctc
aagaacatcatctctccactgaactgcacagcgctcaaaccctatccttga

DBGET integrated database retrieval system