KEGG   Auricularia subglabra: AURDEDRAFT_63331
Entry
AURDEDRAFT_63331  CDS       T03129                                 
Symbol
HTP12
Name
(GenBank) heme-thiolate peroxidase
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
adl  Auricularia subglabra
Brite
KEGG Orthology (KO) [BR:adl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AURDEDRAFT_63331 (HTP12)
Enzymes [BR:adl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     AURDEDRAFT_63331 (HTP12)
SSDB
Motif
Pfam: Peroxidase_2
Other DBs
NCBI-ProteinID: EJD46448
JGI: 63331
LinkDB
AA seq 398 aa
MKLSAGVSALIASTSALSLTLKPYESLAGLSHDDVEAFARSVKVPVGGGQPVPPPIKDTR
SKLVNNRKHPWKPLKKGDQRGPCPGLNALASHGYLPRSGIATPEQIITAVQEGFNMGHDI
AIFVTYAAFLVNGNHLTNLMSIGGLSPLTGTSPPKPALAGGLNVHGTFEGDASLSRSDDF
LGDNHSFNATLFDQISCNLHTKKYGGGRYNMTAAGEVRWRRIQDSVACNPNFFFSNPCFN
TAYTEAIFPIAYFIDGRVKGDGVREATGLDLEVMRGFFRDHHMPKDFHRRESAFGLGDVG
NTSDVLLDMHPIQPGFNNGTVNSYVADPDFFGADEGNTSCALYRKFVNTTLALYPNPRGP
LRKALNVNLDNFYTTASGDEDCLQSHPYPPYPKDTCSE
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgaagctctccgccggcgtctcggcactcatcgcctcgaccagcgctctcagtctgacg
ctcaagccgtacgagtcgctcgccgggctctcgcacgacgatgtggaggcattcgcgcgc
tccgtcaaggtccccgtcggcggcgggcagcccgttccgccgcccatcaaggatacgcgc
tcgaagctcgtcaacaaccgcaagcacccatggaagccgctcaaaaagggcgaccagcgc
ggtccttgcccgggtctgaacgcactggcgtcgcatgggtatctccctcgctcgggcatc
gctaccccagagcagatcatcaccgccgtgcaggagggcttcaatatgggccacgacatc
gccatcttcgtcacatacgccgcattcctggtcaatggcaaccacctcacgaaccttatg
agcattggtggtctttctccgttgaccggcacgtcgccgcccaagccggctctggctggc
ggtctcaacgttcacggcacattcgagggcgatgccagtctctcgcgcagtgacgacttc
ctgggcgataaccatagcttcaatgcaactctgttcgaccagattagctgcaatctccac
accaagaagtacggcggcggacggtacaacatgaccgctgctggtgaagttcgctggcgc
cgcatccaagactcggtcgcgtgcaacccaaacttcttcttcagcaacccctgcttcaac
accgcgtacaccgaggcgatcttccccatcgcatacttcatcgacgggcgggtcaagggc
gacggcgtgcgcgaggccactgggctcgacctcgaggtcatgcgcgggttcttccgcgac
caccacatgccaaaggacttccaccggcgcgagagcgcgttcgggctgggagacgtcggc
aacacgagcgacgtgctgctcgacatgcacccaatccagccgggcttcaacaacggcacg
gtcaacagctacgtcgcggatccggacttcttcggcgcggacgagggcaacacgagctgc
gcgctctaccgcaagttcgtcaacacgacgctcgcgctgtacccgaacccgcgcggcccg
ctgcgcaaggcgctcaacgtcaacctcgacaacttctacacgacggcgtctggggacgag
gactgcctgcagtcgcatccttatccgccttatcccaaggacacctgcagcgagtag

DBGET integrated database retrieval system