KEGG   Auricularia subglabra: AURDEDRAFT_68894
Entry
AURDEDRAFT_68894  CDS       T03129                                 
Symbol
HTP5
Name
(GenBank) heme-thiolate peroxidase
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
adl  Auricularia subglabra
Brite
KEGG Orthology (KO) [BR:adl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AURDEDRAFT_68894 (HTP5)
Enzymes [BR:adl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     AURDEDRAFT_68894 (HTP5)
SSDB
Motif
Pfam: Peroxidase_2
Other DBs
NCBI-ProteinID: EJD41454
JGI: 68894
UniProt: J0DDH9
LinkDB
AA seq 393 aa
MLSFYAVPTILALAATGAVGGIIEPFASLAGRTDAEIEHFIRSNNIVGGRPAPGPIADTS
AKLVNDEHHPWLSLLPFQIRGPCVCPGLNTLASHGWLPRSGVASPGQIVTAVQEGLNMGW
DIAVLITYAAMLVDGNPLTDLLSIGSKTFLTGPAPPKPAIVGGLNTHAVFEGDASMTRGD
AFFGDNHSFNETLFNQLVQASNAFGGGKYNISAAAEVRFNRIQQSIATNPEFFFSIPRYA
TAFAEAVFPIAFFVDGRNTGAAAFELDLTVARGFFQDSRMPRDFHRRDGAFGLDATGEGL
SFLINAHFVPPGFNKGIGNYVVDEETLDIFENGFQICALYDFFVNKTVELYPVPKAKGVL
RQALAQNLANFFLAVKTASSTCPEQFPYGKVHN
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgctttctttctacgccgtaccgaccatcttagctcttgctgccacgggtgctgtcgga
ggcatcatcgagcccttcgcgtctctcgctggccgcaccgatgcagagattgagcatttc
atccgctcgaataacatcgtgggcggaagacctgcgccagggccaatcgcggatacgtct
gcgaagttggtcaatgatgaacatcacccttggctgtcgctcctcccctttcagattcga
ggtccgtgtgtatgtcccggactgaatactctagcatctcacggctggcttcctcgctcg
ggggtcgcttctccgggacagattgtcaccgcagtgcaagagggcctcaatatgggatgg
gacattgctgtgttgatcacctacgccgccatgctcgtcgacggcaacccgctgaccgac
ctcctgagcatcggtagcaagacctttctcacaggccctgctccccccaagcccgccatc
gtcgggggactcaatacccacgcggtattcgagggggatgccagtatgaccagaggcgat
gcgttctttggtgacaatcacagcttcaatgagaccttgtttaaccagttagtccaggcg
agcaacgcatttgggggagggaaatacaacatctcggctgcagcggaagtgcggttcaac
cgtattcaacagagcattgccacgaaccccgagttcttcttcagcatcccccgctatgcc
accgcttttgcggaggcggtctttcccatcgcgttcttcgtcgatggtcgcaacactgga
gccgcagcattcgagctcgacctcaccgtcgcgcgagggttcttccaggatagtcgaatg
ccgagggacttccatcggcgcgacggtgccttcggattggatgcaacgggcgaagggttg
agcttcctgataaacgcgcatttcgtgccccccgggttcaacaagggtatcggaaactac
gtcgtggacgaagaaaccctggatatcttcgagaacggctttcagatatgcgccctatat
gacttcttcgtgaacaagacggtggaactctatccggtgccgaaggctaagggcgtgctg
aggcaggcgttggcccagaacttggccaatttcttcctcgcagtcaagacagcatcgtcg
acgtgtccggagcagtttccttacggaaaagttcataattag

DBGET integrated database retrieval system