KEGG   Achromobacter deleyi: HLG70_09245
Entry
HLG70_09245       CDS       T07788                                 
Name
(GenBank) pyruvate, water dikinase
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
ady  Achromobacter deleyi
Pathway
ady00333  Prodigiosin biosynthesis
ady01100  Metabolic pathways
ady01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ady00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HLG70_09245
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: QVQ28557
LinkDB
Position
2065345..2067927
AA seq 860 aa
MTAPVLDWAAAAQAGPLAAGGKGWQLGRMAQFGVPVPDGFVLPAQASREHRPGQDVPPAV
AQALHEALRVRGWLERPLALRSSTPQEDSAGASFAGIHLSCLNVRGPEAALQALRRIWDS
LWTPQAQAYRQRLGLAADGAGGMAVVVMPMIDAAASGIAFTIDPATGRHDEMLIHANWGL
GESLVNGQAEGDEYRLREDYLRQAWPPAARRTGAKRHATLPAADGPGTRLAATPAPRAAQ
AVLTDAQAEALGDIVRDAARALDYAGAGYDIEWAWDGQRFWIVQARPVTVSARHTYPALQ
AQPAYWSRGNTREVLPQPMSALEWDAGRVMAQRMLTCGFELSGYATLPGVRLAALFQGRA
YLDASVIQWMGYDALGIQPRDMNALLGGPQPEIRVPPLSAAQRLRHGLRILRYLRRAAPL
RRQAATDLPVLLARAQDWLDAPLPDSNAGLGARLREQFQTVLAADELFFLQGSGGGALSK
LLELVDKAVPGEGHALTAALMAGGEPSVTAAQGYALMTLAQLAEQDAQALAWLRTPGRDS
AAWAGALPDGSAFKQAFADFLHRYGHRAIYETYLRNPRWREAPGYLLDSILNLIGADPAA
LRARQDAAARQAWQRVRKALPFWQRALAAKLLASSRIEGNQREAARSVLVAYLAVARKSA
LELGRRTSGPDGLAAADDIFHLNAAEIFALAEGRMAPAALGRRAAARRTQLEAWAALPDA
DVITEYARDGAAAPEPGARTTRTSPDTWRGTPVAGGRAHGRAFVARTPDEGLAMPAGGIL
VAASSDPAWTPLFLRAGAVVMEAGGYLSHAAIVAREFGIPAVVNVQGILQGVATGDLLDV
DATQGTVRRMQDAGPPGNTP
NT seq 2583 nt   +upstreamnt  +downstreamnt
atgaccgccccggtgctggactgggcggccgccgcgcaggccggccccctggccgcgggc
ggcaaaggctggcaattgggccggatggcccaattcggcgtgcccgtgcccgacggcttc
gtgctgccggcccaggccagccgcgaacaccggcccggccaggacgtaccgcccgccgtg
gcgcaggccttgcatgaggcgttgcgcgtccgcgggtggctggagcgtccactggccctg
cgttcctcgacgccccaggaggactctgcgggcgcctcgttcgccggcatccacctgtcc
tgcctgaatgtccgcgggcccgaagccgccttgcaggcgctgcggcgcatctgggattcc
ctgtggacgccccaggcgcaggcttaccggcagcgcctgggcctggcggccgatggcgcc
ggcggcatggccgtggtggtgatgcccatgatcgacgcggcagcctcgggcattgccttc
accatcgaccccgccacgggccgccacgacgagatgctcatccacgccaactggggcctg
ggcgaatccctggtgaacggccaggccgagggcgacgaataccgcctgcgcgaagactat
ctgcgccaggcctggccgccagccgcgcggcggaccggcgccaagcgccacgccaccctg
cccgccgcggacggcccgggcacgcggctggccgccacgcccgccccccgcgccgcccaa
gccgtgctgacggatgcgcaggccgaggccctgggtgacatcgtccgcgacgcagcccgc
gcgctggactacgccggcgcaggctacgacatcgaatgggcctgggatggacagcggttc
tggatcgtgcaggcccggccggtcaccgtgtccgcgcggcacacctatcccgcgctgcaa
gcacagcccgcgtactggtcgcgcggcaacacccgcgaggtcctgccccaacccatgtcg
gcgctggaatgggacgccggccgcgtcatggcccagcgcatgctgacctgcggctttgaa
ctcagcggctacgccaccctgcccggcgtgcggctggcggcgctgttccagggccgcgcc
tatctggacgcctcggtcatccagtggatgggttatgacgcgctgggcatccagcctcgc
gacatgaatgcgctgctgggcggcccgcaacccgagatccgcgtgccgccgctgagcgcc
gcgcagcgcctgcggcacggcttgcgcatcctgcgctatctgcgccgggccgcgcccttg
cgccggcaggccgccaccgatctgcccgtgctgctggcccgcgcgcaggactggctggac
gctcccctgcccgattccaatgcggggctgggcgcccggctgcgcgagcagttccagacc
gtgctggccgcggacgaactgttctttctgcagggctcgggcggcggcgcgctctccaag
ctgctggaactggtggataaagccgtccccggcgaagggcacgccttgaccgccgcgctg
atggcgggcggcgagcccagcgtgaccgcggcgcaaggctatgcgctcatgacgctggcg
cagcttgccgaacaggatgcgcaggcgctggcatggctgcgtacgcccggtcgcgacagc
gccgcctgggccggcgcgctgccggatggcagcgccttcaagcaagccttcgccgacttc
ctgcaccgctacggccaccgcgccatctatgaaacctatctgcgcaacccgcgctggcgc
gaagcgcccggctacctgctggacagcatcctgaacctgatcggcgccgatcccgccgcg
ctgcgcgcccgccaggacgccgcggcccgccaggcatggcagcgcgtgcgcaaggccttg
cccttctggcagcgggcgcttgccgccaagctgctggcctcgtcccgcatcgaaggcaat
cagcgcgaagccgctcgcagcgtgctcgtggcctacctggccgtcgcgcgcaaaagcgca
ctggaattgggccgccgcacgagcggccccgacgggctggccgccgccgacgacatcttc
catctcaacgccgccgagatattcgcgctggcggaaggccggatggcgcccgcggccctg
ggccgccgcgccgcggccagacggacgcagctggaggcctgggccgccctgccggacgcc
gatgtcatcaccgaatacgcgcgagatggcgccgcggcgcccgaaccgggcgcgcggaca
acccgcacttcccccgatacgtggcgcggcaccccggtggcgggcgggcgcgcccatgga
cgcgcctttgtcgcccgcacgccggacgagggcctggccatgccggccggcggcatcctg
gtcgcggcctcgtccgaccccgcctggacgccgctgttcctgcgcgcgggggccgtggtg
atggaagccggcggctacctctcgcacgccgccatcgtggcgcgggagttcggcataccc
gccgtggtcaacgtccaaggcatcctgcaaggcgtcgccaccggcgacctgctggacgtg
gacgccacgcaaggcaccgtgcgccgcatgcaggacgctggcccgcctgggaacacgccc
tag

DBGET integrated database retrieval system