Aeromonas sp. CU5: CK911_13675 Help Entry CK911_13675       CDS       T05327                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism aem  Aeromonas sp. CU5 Pathway aem02024   Quorum sensing aem03018   RNA degradation Brite KEGG Orthology (KO) [BR:aem00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     CK911_13675 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     CK911_13675 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aem03019]     CK911_13675 (hfq)    03036 Chromosome and associated proteins [BR:aem03036]     CK911_13675 (hfq) Messenger RNA biogenesis [BR:aem03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      CK911_13675 (hfq) Chromosome and associated proteins [BR:aem03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     CK911_13675 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Iec3-like_M Motif Other DBs NCBI-ProteinID:  ATL93749 LinkDB All DBs Position complement(3086055..3086414) Genome browser AA seq 119 aa AA seqDB search MTTESPSYSTIEQAFSLGNGQDSALNWLRKNRSQVAIFLVSGIKLEGTISGFDQYSVLLT DAHGNQQLVYKAKISTIAMHSGRPPVNIQRARKPRVSMAPRPHSAPGRYDDNQGGGNNE NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgacaactgaatccccaagctactccaccattgagcaagccttttcccttggtaacggg caagattccgcccttaactggttgcgtaagaatcgcagtcaggttgccatttttctggtg agcggcatcaagctggaaggcaccatcagtggctttgaccagtacagcgtgctgttgacc gatgcccatggtaatcagcagctggtctacaaggccaagatctccaccatcgccatgcac tctggccgtccgccggtgaacatccagcgcgcccgcaagcctcgagtctccatggcgccg cgtccccatagtgccccgggccgttatgatgacaatcagggcggtggcaacaacgagtaa

DBGET integrated database retrieval system