Asticcacaulis excentricus: Astex_3754 Help Entry Astex_3754        CDS       T01378                                  Name (GenBank) single-strand binding protein   KO K03111   single-strand DNA-binding protein Organism aex  Asticcacaulis excentricus Pathway aex03030   DNA replication aex03430   Mismatch repair aex03440   Homologous recombination Brite KEGG Orthology (KO) [BR:aex00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     Astex_3754    03430 Mismatch repair     Astex_3754    03440 Homologous recombination     Astex_3754  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aex03032]     Astex_3754    03400 DNA repair and recombination proteins [BR:aex03400]     Astex_3754    03029 Mitochondrial biogenesis [BR:aex03029]     Astex_3754 DNA replication proteins [BR:aex03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     Astex_3754 DNA repair and recombination proteins [BR:aex03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      Astex_3754   TLS (translesion DNA synthesis) factors    Other SOS response factors     Astex_3754 Mitochondrial biogenesis [BR:aex03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     Astex_3754 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB Motif Other DBs NCBI-ProteinID:  ADU15365 UniProt:  E8RVU3 LinkDB All DBs Position pASTEX02:complement(52124..52531) Genome browser AA seq 135 aa AA seqDB search MELPMKCKVQLIGRLGADPEITTLPNSAQVANLSVATEEYWKDKQGQAQRRTTWHRVKFW SEGTIGFIQRNMAKGQLVEIEGAFRYEEYTDREGVKNKVPVINGTNIMPLSFNDGQPSEQ GASGGAGNDHDDIPF NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggagctacccatgaaatgcaaagttcagctgatcggccgcctcggtgcagacccggaa atcaccaccctcccgaacagcgcccaggtcgccaatctgtctgtcgccactgaagaatac tggaaggacaagcagggccaggcccagcgccgtaccacctggcatcgcgtcaagttctgg tcggaaggcacgatcggcttcatccaacgcaatatggccaagggccaactggtcgaaatc gaaggcgccttccgctacgaggagtacaccgatcgcgagggcgtgaagaacaaggttcct gtcatcaatggcacgaacatcatgccgctctccttcaacgatggccagcccagcgagcag ggggccagcggtggcgcgggcaacgaccacgacgacattccgttctga

DBGET integrated database retrieval system