KEGG   Aspergillus fumigatus: AFUA_6G12070
Entry
AFUA_6G12070      CDS       T01017                                 

Definition
(RefSeq) FAD binding domain protein
  KO
K23668  fumiquinazoline A oxidase [EC:1.5.3.-]
Organism
afm  Aspergillus fumigatus
Pathway
afm00998  Biosynthesis of various secondary metabolites - part 2
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
Module
afm_M00901  Fumiquinazoline biosynthesis, tryptophan + alanine + anthranilate => fumiquinazoline
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    AFUA_6G12070
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.-  
     AFUA_6G12070
SSDB
Motif
Pfam: FAD_binding_4 BBE
Other DBs
NCBI-GeneID: 3508391
NCBI-ProteinID: XP_751086
UniProt: Q4WLW6
LinkDB
Position
6
AA seq 497 aa
MQYIPFLISGLVPVALSKSLFEATSNTRIDGNDIAAIFGPVLTPEAHIFLPSDGDYDDNV
MARWSTFNDPSYVATVKPATETDVQAIREYQVSTAASHNITFFATGGGHGVKLNFGNVQN
AINIELSLLDFIDLDLDNEVVTIGPGVENAQLYDLLSSVGKETALTGERCVNTIGPTLGG
GLGPLYGIRGPQVDSLVSARLVTASGDVITVSRSENRDLFWAIRGAGANFGIVTSATYRI
YDQTNGGMAVSAQFAFAPAVNRSVFDLMESMNDEYPPGMSGGMILSYNHTTNEPSVQWNL
LFMGSNEDAQPWLDKIQALGPIDSSIRNVPWHRRDEPEVPYCERGQHYILYNLNLRRTDA
ATLQSYFDSFVDFSSKNPWFDCDLMYERQATDAALAVPLSERGVGPWRDSKINANFLVVT
PSEEYDEAADAFVRPFMDRFQAVMGFDTLHVYVNEALGDEGPASWYGEENLPRLVALKQQ
WDPENKFGAGAPIPLSL
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgcagtacatccccttcctgatctcggggctggtccctgttgcgctatcaaagtccctt
ttcgaagcgacgagcaacaccaggattgatgggaatgatatcgccgccatcttcggtccg
gtcttgacaccagaggcccatatcttcctcccctccgacggtgactacgacgataatgtg
atggctcgatggtcgacattcaacgacccgtcctacgtcgccactgttaagcctgcgacg
gagacagatgtccaagcaattagagaatatcaggtttccactgctgcctcgcacaatata
acttttttcgcaactggtggcggacacggcgtaaagttgaactttggcaatgtgcaaaat
gccataaatatcgaattgagcctgcttgacttcatcgatctggaccttgacaatgaggtg
gtcaccatcggacccggggtggaaaatgcccagctttatgaccttctgtcctccgtgggg
aaagagaccgcactaactggcgagcgctgcgtcaacaccatcggccctacgcttggggga
gggttggggcccctctacggcattcgtggcccgcaggtagattctcttgtgtccgctcgc
ttggtaacagcttccggggatgtgataactgtctccaggagcgagaatcgagatctcttc
tgggctatcaggggtgctggtgcgaactttggtatcgtcacgtcggccacctacaggatc
tacgaccagaccaatggtggaatggctgtgtccgcccagtttgccttcgcgcctgccgtc
aatcgctcggtattcgatctgatggaatccatgaatgatgagtatcccccggggatgtct
ggggggatgatactcagctataatcatacaaccaacgagccctcggtccaatggaatctc
ttgttcatggggtccaatgaagatgcccagccgtggctcgacaagatccaggccctgggt
ccgatcgactcgagtatccgcaacgtcccgtggcatcgcagggatgaacccgaagtgcca
tattgtgagagaggacaacactatatcctttacaacctgaacctcagaagaacagatgca
gccactttgcagtcctacttcgatagcttcgtcgacttctcctccaaaaacccctggttc
gattgcgatctcatgtatgaacggcaggcgaccgacgccgcgctggcagtgcctcttagc
gagaggggagtagggccatggcgggacagtaaaatcaatgcaaactttctcgtggtgacc
ccttccgaagagtatgatgaagctgctgatgccttcgtgcgaccatttatggatcgattc
caggcagtcatgggcttcgacactctccatgtgtacgtcaacgaggcgctgggtgacgaa
ggtcccgcgtcatggtatggggaggaaaacctcccgagacttgttgcgctgaaacaacaa
tgggacccggaaaataaatttggtgccggggctccgattccgttgagtctgtag

DBGET integrated database retrieval system