Aythya fuligula (tufted duck): 116487412 Help Entry 116487412         CDS       T07966                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism aful  Aythya fuligula (tufted duck) Pathway aful04010   MAPK signaling pathway aful04020   Calcium signaling pathway aful04114   Oocyte meiosis aful04218   Cellular senescence aful04310   Wnt signaling pathway aful04370   VEGF signaling pathway aful04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:aful00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116487412 (PPP3R1)    04310 Wnt signaling pathway     116487412 (PPP3R1)    04370 VEGF signaling pathway     116487412 (PPP3R1)    04020 Calcium signaling pathway     116487412 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     116487412 (PPP3R1)    04218 Cellular senescence     116487412 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116487412 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aful01009]     116487412 (PPP3R1) Protein phosphatases and associated proteins [BR:aful01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      116487412 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  116487412 NCBI-ProteinID:  XP_032040223 UniProt:  A0A6J3CSE4 LinkDB All DBs Position 3:9046919..9082995 Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagctaccctttggaaatgtgctcgcactttgatgctgatgagatt aaacgactaggaaagagatttaagaagcttgatttggacaactctggttctttgagtgtg gaagagttcatgtctttacctgaattgcaacagaatccgttagtacagcgagtaatagat atatttgacacagatggcaatggagaagtggacttcaaagaatttatagaaggagtctcc cagttcagtgtcaaaggagataaggaacagaagttgaggtttgcttttcgcatttatgat atggacaaagatgggtatatctcaaatggagagctcttccaggtgctgaagatgatggtt gggaacaatctcaaagacactcagttacagcaaattgtagataaaaccataattaatgca gataaggatggtgatggaagaatatcttttgaagaattctgtgctgttgtaggaggccta gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system