KEGG   Aspergillus flavus: AFLA_006300
Entry
AFLA_006300       CDS       T01090                                 
Name
(GenBank) hypothetical protein
  KO
K24856  NADPH-dependent reductase
Organism
afv  Aspergillus flavus
Pathway
afv00254  Aflatoxin biosynthesis
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
Module
afv_M00937  Aflatoxin biosynthesis, malonyl-CoA => aflatoxin B1
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    AFLA_006300
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Peripla_BP_6 DUF374 THF_DHG_CYH_C DUF664 2-Hacid_dh_C Peptidase_M17_N
Other DBs
NCBI-ProteinID: KAF7621008
LinkDB
AA seq 262 aa
MSDNHRLDGKVALVTGAGRGIGAAIAVALGERGAKVVVNYAHSREAAEKVVEQIKANGTD
AIAIQADVGDPEATAKLMAETVRHFGYLDIVSSNAGIVSFGHLKDVTPEEFDRVFRVNTR
GQFFVAREAYRHMREGGRIILTSSNTACVKGVPKHAVYSGSKGAIDTFVRCMAIDCGDKK
ITVNAVAPGAIKTDMFLAVSREYIPNGETFTDEQVDECAAWLSPLNRVGLPVDVARVVSF
LASDAAEWVSGKIIGVDGGAFR
NT seq 789 nt   +upstreamnt  +downstreamnt
atgtccgacaaccaccgtttagatggcaaagtggccttagtcaccggcgccggccgcggc
atcggtgctgccatcgccgtcgcgcttggtgagcgcggagccaaagtcgtggtgaactac
gcccattcccgtgaggccgcggagaaagtggttgaacagatcaaggccaatggtaccgac
gctatcgcaatccaggccgatgtcggggatcctgaggcaactgcgaagttaatggcggag
acggtgcgccattttggctacctggacatcgtgtcatcgaacgctggaattgtatcgttc
ggtcacctgaaagacgtgaccccagaagaatttgaccgggtcttccgggtcaacacccgt
ggccagttcttcgtggcgcgggaggcctatcgccatatgcgggaaggaggtcgaattatc
ctgaccagctctaacactgcttgcgtgaagggggtccccaagcatgctgtatactccggg
tccaagggggctattgacacctttgttcgctgcatggcaatcgactgcggagacaagaag
atcaccgtgaatgccgtggctcctggagccattaagactgatatgtttttggctgtgtcg
cgggagtatatccccaatggtgagactttcaccgatgagcaggtagacgagtgcgccgct
tggctctcgcctttgaaccgggtgggcctccctgtggacgtcgcccgggtagtgagcttc
ctggcatctgatgcagccgaatgggtaagtggaaagatcattggggtggatggcggcgct
tttcgatga

DBGET integrated database retrieval system