KEGG   Addendum: AAA21342
Entry
AAA21342          CDS       T10000                                 
Symbol
tylB
Name
(KEGG) dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose transaminase (EC:2.6.1.89)
  KO
K19854  dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose transaminase [EC:2.6.1.89]
Taxonomy
TAX:1906
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces fradiae)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 AMP-binding
Other DBs
NCBI-ProteinID: AAA21342
GB: U08223
UniProt: Q54142
LinkDB
AA seq 388 aa
MTGLPRPAVRVPFHDLRDVHAATGVESEIGGALLRVAARGRYLLGAELAAFEERFAEYCG
NAHCVAVGSGLDDARLALWALGVGEGDEVIVPSHTFIASWLAVSATGATPVPVEPGDPGE
PGPGAFLLDPDRLEAALTPRTRAVMPVHLYGHPVDLDPVGAFAEPHGLAVVEDAAQATAR
YRGRRIGSGHRTAFSFYPGKNLGALGDGGAVVTSDPELADRLRLLRNYGAREKYRHEERG
TNSRLDELQAAVLSVKLPYLDAWNTRRREIAARYGEALAGLPGVTVPEGRVAEPVWHQYV
LRSPYRDRLRRRLAEAGVETLVHYPVAVHASGAYAGAGPCPAGGLPRAERLAGEVLSLPI
GPHLPDEAVEVVIAAVQSAALDSWEEGP
Reference
PMID:7984112
  Authors
Merson-Davies LA, Cundliffe E
  Title
Analysis of five tylosin biosynthetic genes from the tyllBA region of the Streptomyces fradiae genome.
  Journal
Mol Microbiol 13:349-55 (1994)
DOI:10.1111/j.1365-2958.1994.tb00428.x
Reference
  Authors
Melancon CE 3rd, Hong L, White JA, Liu YN, Liu HW
  Title
Characterization of TDP-4-keto-6-deoxy-D-glucose-3,4-ketoisomerase from the D-mycaminose biosynthetic pathway of Streptomyces fradiae: in vitro activity and substrate specificity studies.
  Journal
Biochemistry 46:577-90 (2007)
DOI:10.1021/bi061907y

DBGET integrated database retrieval system