KEGG   Addendum: AAD13625
Entry
AAD13625          CDS       T10000                                 
Symbol
tcbC
Name
(KEGG) catechol 1,2-dioxygenase
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Taxonomy
TAX:306
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas sp.)
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg
Other DBs
NCBI-ProteinID: AAD13625
GB: M57629
UniProt: P27098
LinkDB
AA seq 251 aa
MNERVKQVASALVDAIQKTLTEQRVTEEEWRAGVGYMMKLAEAKEVAVLLDAFFNHTIVD
LKAQATRGSRPAMQGPYFLEGAPVVAGALKTYEDDSHHPLVIRGAVRTDDGAPAAGAVID
VWHSTPDGKYSGIHDQIPTDMYRGKVVADAQGKYAVRTTMPAPYQIPNKGPTGVLLEMMG
SHTWRPAHVHFKVRKDGFAPLTTQYYFEGGDWVDSDCCKGVAPDLVMPTKTEGGAQVMDI
DFVIERAREHV
Reference
PMID:2013566
  Authors
van der Meer JR, Eggen RI, Zehnder AJ, de Vos WM
  Title
Sequence analysis of the Pseudomonas sp. strain P51 tcb gene cluster, which encodes metabolism of chlorinated catechols: evidence for specialization of catechol 1,2-dioxygenases for chlorinated substrates.
  Journal
J Bacteriol 173:2425-34 (1991)
DOI:10.1128/JB.173.8.2425-2434.1991

DBGET integrated database retrieval system