KEGG   Addendum: AAL57240
Entry
AAL57240          CDS       T10000                                 
Symbol
6GT
Name
(KEGG) betanidin 6-O-glucosyltransferase
  KO
K15775  betanidin 6-O-glucosyltransferase [EC:2.4.1.-]
Taxonomy
TAX:90527
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Aizoaceae; Cleretum
Organism
Cleretum bellidiforme
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-ProteinID: AAL57240
GB: AF374004
UniProt: Q8W237
LinkDB
AA seq 481 aa
MSKIELVLVPTPGMGHLLSAVELSKLIIRRENRISVLILILSFPFDSGLVNAYVDFQSRD
PDNSGSLTFITLPPLSNIPDCTSSTFFTTVIELHKPNVKQVVEERVRSGSPKPAGFVIDM
LCPAMMDVAEELEVPSYILFTSGANLLNVVFHFLSLADNGVDIATEVNDPDKEVDVPGFR
NRVPCKVLPLPFLEKDFLVKRGRRFRRSNGILVNTSNELESYAIQTLLEQAKDNKIPPVY
PVGPILELNSKSRCGTKEDEEVSIMRWLDEQPVNSVLFVCFGSMGTFDEDQVKEIANGLE
QSGYCFLWSLRQPPPEGKATPSEEAFLDTLPEGFVERTSHKGKIIGWAPQVSILAHKAVG
GFVSHCGWNSTLESLWFGVPMATWPISAEQQLNAFELVKEFGMAVEIRMDFWRDCRKNTQ
SFVVTSEEIENGVKKLMSMDEEMVEKVKKMSDKSRKTLEDGGSSHHSLGRFINDLLENAG
F
Reference
  Authors
Vogt T
  Title
Substrate specificity and sequence analysis define a polyphyletic origin of betanidin 5- and 6-O-glucosyltransferase from Dorotheanthus bellidiformis.
  Journal
Planta 214:492-5 (2002)
DOI:10.1007/s00425-001-0685-1

DBGET integrated database retrieval system