KEGG   Addendum: AAM70356
Entry
AAM70356          CDS       T10000                                 
Symbol
calO6
Name
(KEGG) orsellinic acid C2-O-methyltransferase
  KO
K21255  orsellinic acid C2-O-methyltransferase [EC:2.1.1.-]
Taxonomy
TAX:1877
  Lineage
Bacteria; Actinobacteria; Micromonosporales; Micromonosporaceae; Micromonospora
Organism
ag  Addendum (Micromonospora echinospora)
SSDB
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_12 Methyltransf_25 HTH_IclR MTS HTH_5 PDZ_6 Methyltransf_31
Other DBs
NCBI-ProteinID: AAM70356
GB: AF497482
UniProt: Q8KND2
Structure
LinkDB
AA seq 356 aa
MELTTTAARPGLRHRMQQLIYGFFTAQTLHVAVRLRIPDLLADGARDVGDLASATGADAP
SLRRLLRALVFLEVLDEPAPGTFALTEQGEVLRADVTGSMRELVLLLSGPESWAAWGQLE
HSVRTGEVAWEHVHGRSCFDHLMADPQRQAAFNAAMAEGSRAFVPTLLSAYDFGDLRTVV
DVGGGSGALLAGVLAAHPHLRGTVFDTPDGVADAARTVAEQGVADRCGVETGDFFVSVPP
GADAYVLKSVLHDWDDEQCVEVLRTVRRAVRPDSRVILVESLMPTTVTTAPSVAQVVMND
LNMMVCHGGRERTVAEFRELLRVAGFRLESVTPCPAPSVVGILEAAPAPATGPDGS
Reference
  Authors
Ahlert J, Shepard E, Lomovskaya N, Zazopoulos E, Staffa A, Bachmann BO, Huang K, Fonstein L, Czisny A, Whitwam RE, Farnet CM, Thorson JS
  Title
The calicheamicin gene cluster and its iterative type I enediyne PKS.
  Journal
Science 297:1173-6 (2002)
DOI:10.1126/science.1072105

DBGET integrated database retrieval system