KEGG   Addendum: AAR85519
Entry
AAR85519          CDS       T10000                                 
Symbol
qdtB
Name
(KEGG) dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose transaminase
  KO
K24250  dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose transaminase [EC:2.6.1.89]
Taxonomy
TAX:1517
  Lineage
Bacteria; Firmicutes; Clostridia; Thermoanaerobacterales; Thermoanaerobacterales Family III. Incertae Sedis; Thermoanaerobacterium
Organism
ag  Addendum (Thermoanaerobacterium thermosaccharolyticum)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP OKR_DC_1 Beta_elim_lyase
Other DBs
NCBI-ProteinID: AAR85519
GB: AY422724
UniProt: Q6TFC4
Structure
LinkDB
AA seq 365 aa
MKISFASFKPMHDEIEYEIKFKFEEIYKRNWFILGDEDKKFEQEFADYCNVNYCIGCGNG
LDALHLILKGYDIGFGDEVIVPSNTFIATALAVSYTGAKPIFVEPDIRTYNIDPSLIESA
ITEKTKAIIAVHLYGQPADMDEIKRIAKKYNLKLIEDAAQAHGSLYKGMKVGSLGDAAGF
SFYPAKNLGSLGDGGAVVTNDKDLAEKIKALSNYGSEKKYHHIYKGFNSRLDELQAGFLR
VKLKYLDKWNEERRKIAQKYIAGINNPNVIIPVEADYAKHVWYTFVIRSEKRDELQKYLN
NNGIGTLIHYPIPIHLQQAYKDLGFKTGNFPIAEKIANEILSIPIWYGMKNEEIEYVIDK
INAWK
Reference
PMID:7744045
  Authors
Altman E, Schaffer C, Brisson JR, Messner P
  Title
Characterization of the glycan structure of a major glycopeptide from the surface layer glycoprotein of Clostridium thermosaccharolyticum E207-71.
  Journal
Eur J Biochem 229:308-15 (1995)
DOI:10.1111/j.1432-1033.1995.tb20470.x
Reference
  Authors
Pfostl A, Zayni S, Hofinger A, Kosma P, Schaffer C, Messner P
  Title
Biosynthesis of dTDP-3-acetamido-3,6-dideoxy-alpha-D-glucose.
  Journal
Biochem J 410:187-94 (2008)
DOI:10.1042/BJ20071044

DBGET integrated database retrieval system