KEGG   Addendum: AAU00094
Entry
AAU00094          CDS       T10000                                 
Symbol
phpJ
Name
(KEGG) aldehyde dehydrogenase
  KO
K12907  aldehyde dehydrogenase
Taxonomy
TAX:1938
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces viridochromogenes)
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-ProteinID: AAU00094
GB: AY632421
UniProt: Q5IW32
LinkDB
AA seq 466 aa
MFVNGALQPARRHTTVHDRWTGEPVGTVPRDGAEEAAAAVAALAAGRRATTPQQRSAVLT
RAADMLTARAEEFSTLITAESGVCRKETLREVSRAAGNLRVAAAEAERIRGESIPLPDGT
RLAVTLPEPVGVVLGITPFNRPLNQVVVKAAPALAAGCPLLLKPSEKTPLTALAFAELLV
EAGCAKDMLAVVTGEPGEVGPPLAAHPDVAMVTFTGSVATGHAVAAQAAGKRQLLELGGN
DPLFVLPDADLRRAAKLAADGSCATAGQSCRGIKRVFVWEEVADEFTALLEPAVAAKRAG
DPRREDTDLGPLVSEEAALVVERRIARAVRDGARLVTGGERDGALVRPAVLDHVPPDTEL
VTEETFGPVAPVIRVRDADEAVRLSNGTAYGLQAGVLTRDSAAFWDIAARLRVGAVNLGE
GPHFDSPHIPFGGVKSSGVGREGIRYAIAEMTVTKTVTLPGPYGTG
Reference
  Authors
Blodgett JA, Zhang JK, Metcalf WW
  Title
Molecular cloning, sequence analysis, and heterologous expression of the phosphinothricin tripeptide biosynthetic gene cluster from Streptomyces viridochromogenes DSM 40736.
  Journal
Antimicrob Agents Chemother 49:230-40 (2005)
DOI:10.1128/AAC.49.1.230-240.2005
Reference
  Authors
Blodgett JA, Thomas PM, Li G, Velasquez JE, van der Donk WA, Kelleher NL, Metcalf WW
  Title
Unusual transformations in the biosynthesis of the antibiotic phosphinothricin tripeptide.
  Journal
Nat Chem Biol 3:480-5 (2007)
DOI:10.1038/nchembio.2007.9

DBGET integrated database retrieval system