| Entry |
|
|---|
| Symbol |
oxyC
|
|---|
| Name |
(KEGG) oxy minimal PKS acyl carrier protein
|
|---|
| KO |
| K05553 | minimal PKS acyl carrier protein |
|
|---|
| Taxonomy |
|
|---|
| Lineage |
Bacteria; Bacillati; Actinomycetota; Actinomycetes; Kitasatosporales; Streptomycetaceae; Streptomyces |
|---|
| Organism |
Streptomyces rimosus
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| AA seq |
95 aa
MTLLTLSDLLTLLRECAGEEESIDLGGDVEDVAFDALGYDSLALLNTVGRIERDYGVQLG
DDAVEKATTPRALIEMTNASLTGASPSAGGAARDK |
|---|
| Reference |
|
|---|
| Authors |
Zhang W, Ames BD, Tsai SC, Tang Y |
|---|
| Title |
Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. |
|---|
| Journal |
|
|---|
