KEGG   Addendum: AAZ78334
Entry
AAZ78334          CDS       T10000                                 
Symbol
oxyK
Name
(KEGG) bifunctional cyclase/aromatase
  KO
K14249  bifunctional cyclase/aromatase [EC:4.2.1.-]
Taxonomy
TAX:1927
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
Streptomyces rimosus
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc AHSA1 DUF2505
Other DBs
NCBI-ProteinID: AAZ78334
GB: DQ143963
UniProt: Q3S8Q5
LinkDB
AA seq 317 aa
MPAPTSHRAVHRTEIDAPADRVYALIRDAAEWPRHFTPTVHVERAELDARSERLRIWATA
NGEVKHWTSHRALDPEGQSVRFRQEVCSPPVAAMSGEWVLRDLPGGRCELTLHHTFAAVD
DRPEDVEWITTATDRNSRTELANIKALAEAAGSDAELLFSFEDSETVHAPAEAVYAFLAE
AGKWPDRLPHVSRLDLTEPSDGVQVMTMVTRANDGSEHTTESVRVCFPDELRIVYKQIGT
PPLMTLHTGEWSIRDTGDGLLVTSQHTIRINESAIPEILGADATAADARARVRAAVGGNS
AATLALAKRFAEAPHAA
Reference
  Authors
Zhang W, Ames BD, Tsai SC, Tang Y
  Title
Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase.
  Journal
Appl Environ Microbiol 72:2573-80 (2006)
DOI:10.1128/AEM.72.4.2573-2580.2006

DBGET integrated database retrieval system