KEGG   Addendum: ABC00744
Entry
ABC00744          CDS       T10000                                 
Symbol
dntB
Name
(KEGG) 4-methyl-5-nitrocatechol 5-monooxygenase (EC:1.14.13.210)
  KO
K21683  4-methyl-5-nitrocatechol 5-monooxygenase [EC:1.14.13.210]
Taxonomy
TAX:233098
  Lineage
Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia
Organism
ag  Addendum (Burkholderia sp. DNT)
SSDB
Motif
Pfam: FAD_binding_3 DAO Pyr_redox Pyr_redox_2 FAD_binding_2 NAD_binding_8
Other DBs
NCBI-ProteinID: ABC00744
GB: DQ298257
UniProt: Q2PWU9
LinkDB
AA seq 548 aa
MTRPLETPPDIEVPVLIVGGSMVGLSTALFLSHYGIQAMAVERHERTAIHPRAGHFHLRT
LELLRSVGLEEVVARTSAEAFFPNGGINAVQSLAGGETASFISNLNAGVEEFSPTRRLFI
AQQALEPILRSRAEELGADLRYSTEVVSVVDDGEGVTTVIRDKASGQERTVRSRYLVASD
GWRSQRRAQLGIETRGQGLLSRSATIYFRADCRELLAGTHLGVIYVLNERLRGFFRFEKS
LQSGFLGVATLGDPTRPGALDVSAGFTTDTAVELVRAAIGVPDIDVEIQDVAHWEATAAL
ADRYRGGRIFLAGDAAHVVPPYGGFGGNTGVQDAHNLASKLALVLDGTAGEALLDTYEAE
RRPVGALTVDQAFSRYIRRLAPEFLDEQTPELVDDFSMELGYRYHSPAVLTEDDDKAVDQ
AVVGHPREALGRPGSRAPHVALRVDDHDRSVLDLLGRDFVVLAGPAGQVWAEAAERASKE
LGLPLSAYVVGSDTPVADVEGRFADAYGLSDAGVALVRPDGFIAWRSRDLAEDPEAALTD
ALRAVLCR
Reference
  Authors
Leungsakul T, Johnson GR, Wood TK
  Title
Protein engineering of the 4-methyl-5-nitrocatechol monooxygenase from Burkholderia sp. strain DNT for enhanced degradation of nitroaromatics.
  Journal
Appl Environ Microbiol 72:3933-9 (2006)
DOI:10.1128/AEM.02966-05

DBGET integrated database retrieval system