KEGG   Addendum: ABR14721
Entry
ABR14721          CDS       T10000                                 
Symbol
CYP719A13
Name
(KEGG) (S)-nandinine synthase (EC:1.14.19.73)
  KO
K13395  (S)-stylopine/(S)-canadine/(S)-nandinine synthase [EC:1.14.19.64 1.14.19.68 1.14.19.73]
Taxonomy
TAX:54796
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Papaveraceae; Papaveroideae; Argemone
Organism
ag  Addendum (Argemone mexicana)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ABR14721
GB: EF451151
UniProt: B1NF19
LinkDB
AA seq 504 aa
MEEKIMTNNSPWILTSSTTTTTTILLSLLFTIFIILRRNKSSSSKMVWPTGPKTLPIIGN
MNILGGTALHVVLHNLAKTYGNVMTIWIGSWRPVIVVSDIDRAWEVLVNKSSDYSARDMP
EITKLATADWKTISSSDSGPFWTNLRKGLQNVALSPQNLSSQSKFQERDIIKTIQNLKEE
AKMNNGIVKPLDHLKKAMVRLISRLIYGQDFDNDEYVEEMHHTIEELIRVSGYARLAEAF
YYAKYLPSHKKAVREVLQANQRVQNLVRPLLSLNSPTNTYLHFLRSQNYEDEVIIFAIFE
AYLLGVDSTSSTTAWALAYLIREPNVQEKLYEELKNFTNDNDRKMVKFEDLNKLQYLQAV
VKETMRMKPIAPLAIPHKACRETSLMGRKVNQGTRVMVNIYALHHNQNVWKEPYKFNPER
FLQKNQDGVDGKAMEQSLLPFSAGMRICAGMELGKLQFSFALANLVNAFKWSCVSDGVFP
DMSDQLGFVLLMKTPLEAGIVPRM
Reference
  Authors
Diaz Chavez ML, Rolf M, Gesell A, Kutchan TM
  Title
Characterization of two methylenedioxy bridge-forming cytochrome P450-dependent enzymes of alkaloid formation in the Mexican prickly poppy Argemone mexicana.
  Journal
Arch Biochem Biophys 507:186-93 (2011)
DOI:10.1016/j.abb.2010.11.016

DBGET integrated database retrieval system