KEGG   Addendum: ABV49596
Entry
ABV49596          CDS       T10000                                 
Symbol
ang-ORF14
Name
(KEGG) TDP-4-keto-6-deoxyhexose reductase
  KO
K19859  dTDP-4-keto-6-deoxyhexose reductase
Taxonomy
TAX:42237
  Lineage
Bacteria; Actinomycetota; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
Streptomyces eurythermus
Module
42237_M00803  dTDP-D-angolosamine biosynthesis
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_10 KR UDPG_MGDP_dh_N Glyco_transf_4 NmrA adh_short
Other DBs
NCBI-ProteinID: ABV49596
GB: EU038272
UniProt: A8CAA9
LinkDB
AA seq 333 aa
MVNDPMPRGSGSGSVVVLGGAGYVGRHVCAAFAARGRDVVVVGRRPPEEPMPYRCVTLDL
AGTDPAALAAALDAERPDTIVNSVGSIWGRTDEQMWSATAVPTLRLLEALALMSARPRLV
HLGSVLEYGPVTPGGSVGADAVPRPDTAYGRSKLAASEAVLRGTSGGWVDGVVLRVSNVS
GPGTPRISLLGQVAERLLAAAGTGAEAVVELSRLRAHRDYVDVRDVADAVVAAARAPAVP
VAVGIGRGEAVAVRDLVGLFIEASGIPARVVERPAPGRAPGHREDWLRVDTGAARALLGW
APRRSLRESVRDCWHDLVRAHRLPTTPSKHSGG
Reference
  Authors
Schell U, Haydock SF, Kaja AL, Carletti I, Lill RE, Read E, Sheehan LS, Low L, Fernandez MJ, Grolle F, McArthur HA, Sheridan RM, Leadlay PF, Wilkinson B, Gaisser S
  Title
Engineered biosynthesis of hybrid macrolide polyketides containing D-angolosamine and D-mycaminose moieties.
  Journal
Org Biomol Chem 6:3315-27 (2008)
DOI:10.1039/b807914e

DBGET integrated database retrieval system