KEGG   Addendum: ADJ94127
Entry
ADJ94127          CDS       T10000                                 

Gene name
ido
Definition
(KEGG) L-isoleucine 4-hydroxylase (EC:1.14.11.45)
  KO
K20418  L-isoleucine 4-hydroxylase [EC:1.14.11.45]
Taxonomy
TAX:1428
  Lineage
Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus cereus group
Organism
ag  Addendum (Bacillus thuringiensis)
SSDB
Motif
Pfam: 2OG-Fe_Oxy_2
Other DBs
NCBI-ProteinID: ADJ94127
GB: HM358019
UniProt: E2GIN1
LinkDB
AA seq 240 aa
MKMSGFSIEEKVHEFESKGFLEISNEIFLQEEENHSLLTQAQLDYYNLEDDAYGECRARS
YSRYIKYVDSPDYILDNSNDYFQSKEYNYDDGGKVRQFNSINDSFLCNPLIQNIVRFDTE
FAFKTNIIDKSKDLIIGLHQVRYKATKERPSFSSPIWLHKDDEPVVFLHLMNLSNTAIGG
DNLIANSPREINQFISLKEPLETLVFGQKVFHAVTPLGTECSTEAFRDILLVTFSYKETK
Reference
  Authors
Smirnov SV, Kodera T, Samsonova NN, Kotlyarova VA, Rushkevich NY, Kivero AD, Sokolov PM, Hibi M, Ogawa J, Shimizu S
  Title
Metabolic engineering of Escherichia coli to produce (2S, 3R, 4S)-4-hydroxyisoleucine.
  Journal
Appl Microbiol Biotechnol 88:719-26 (2010)
DOI:10.1007/s00253-010-2772-3
Reference
  Authors
Kodera T, Smirnov SV, Samsonova NN, Kozlov YI, Koyama R, Hibi M, Ogawa J, Yokozeki K, Shimizu S
  Title
A novel l-isoleucine hydroxylating enzyme, l-isoleucine dioxygenase from Bacillus thuringiensis, produces (2S,3R,4S)-4-hydroxyisoleucine.
  Journal
Biochem Biophys Res Commun 390:506-10 (2009)
DOI:10.1016/j.bbrc.2009.09.126
Reference
  Authors
Hibi M, Kawashima T, Kodera T, Smirnov SV, Sokolov PM, Sugiyama M, Shimizu S, Yokozeki K, Ogawa J
  Title
Characterization of Bacillus thuringiensis L-isoleucine dioxygenase for production of useful amino acids.
  Journal
Appl Environ Microbiol 77:6926-30 (2011)
DOI:10.1128/AEM.05035-11

DBGET integrated database retrieval system