KEGG   Addendum: AEI98657
Entry
AEI98657          CDS       T10000                                 
Symbol
ctcN
Name
(KEGG) anhydrotetracycline 6-monooxygenase
  KO
K14256  anhydrotetracycline 6-monooxygenase / 5a,11a-dehydrotetracycline 5-monooxygenase [EC:1.14.13.38 1.14.13.234]
Taxonomy
TAX:1894
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Kitasatospora
Organism
ag  Addendum (Kitasatospora aureofaciens)
SSDB
Motif
Pfam: FAD_binding_3 DAO Pyr_redox HI0933_like Pyr_redox_2 Pyr_redox_3 FAD_binding_2 Thi4 NAD_binding_8 DUF1059 ApbA FAD_oxidored HlyE
Other DBs
NCBI-ProteinID: AEI98657
GB: HM627755
UniProt: S4S3A2
LinkDB
AA seq 490 aa
MDCDVVVAGAGPTGLMLACELALGGARAVVVERRREPEKHSKAMGMQGRTVELLELRGLL
DRFKEGAGVLQGGNFASLGVPMRFEEFDTRHPYVLLVPQLRTEELLAERARELGVRIVRG
SGVTGFAQDADGVTVETDTGPLRARYLVGCDGGGSTVRKAAGISFTGQDPHMYALIGDMR
FSGDLPRGEGLGPMRPVGLVNPAKRSWFGAFQHQPGVYRATVAWFDRPFADRRAPVTEEE
MRAALVEHTGSDHGMHDVTWLSRLTDVSRLADCYRQGRVLLAGDAAHIHLPAGGQGLNLG
FQDAVNLGWKLAAVVRGHGTEELLDSYGRERRPIADGVVRNTRTQAVLIDPDPRYEALRQ
TFRDLMALPDTNRHIAGMLSGFDVAYGGGDHPLVGRRMPDAELITADGPRRISDCFAGAR
GLLLLPEQAPTASPLAAWADRVDTLTVKSGGPDADTAHLVRPDGYVAWAGEPARTEELHH
AATTWFGAAA
Reference
  Authors
Zhu T, Cheng X, Liu Y, Deng Z, You D
  Title
Deciphering and engineering of the final step halogenase for improved chlortetracycline biosynthesis in industrial Streptomyces aureofaciens.
  Journal
Metab Eng 19:69-78 (2013)
DOI:10.1016/j.ymben.2013.06.003

DBGET integrated database retrieval system