KEGG   Addendum: AEL16716
Entry
AEL16716          CDS       T10000                                 
Symbol
SSL-2
Name
(KEGG) Botryococcus squalene synthase (EC:1.3.1.96)
  KO
K21149  botryococcus squalene synthase [EC:1.3.1.96]
Taxonomy
TAX:38881
  Lineage
Eukaryota; Viridiplantae; Chlorophyta; core chlorophytes; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Elliptochloris clade; Botryococcus
Organism
ag  Addendum (Botryococcus braunii)
SSDB
Motif
Pfam: SQS_PSY NAD_binding_9
Other DBs
NCBI-ProteinID: AEL16716
GB: HQ585059
UniProt: G0Y287
LinkDB
AA seq 465 aa
MVKLVEVLQHPDEIVPILQMLHKTYRAKRSYKDPGLAFCYGMLQRVSRSFSVVIQQLPDE
LRHPICVFYLILRALDTVEDDMNLPNEVKIPLLRTFHEHLFDRSWKLKCGYGPYVDLMEN
YPLVTDVFLTLSPGAQEVIRDSTRRMGNGMADFIGKDEVHSVAEYDLYCHYVAGLVGSAV
AKIFVDSGLEKENLVAEVDLANNMGQFLQKTNVIRDYLEDINEEPAPRMFWPREIWGKYA
QELADFKDPANEKAAVQCLNHMVTDALRHCEIGLNVIPLLQNIGILRSCLIPEVMGLRTL
TLCYNNPQVFRGVVKMRRGETAKLFMSIYDKRSFYQTYLRLANELEAKCKGEASGDPMVA
TTLKHVHGIQKSCKAALSSKELLAKSGSALTDDPAIRLLLLVGVVAYFAYAFNLGDVRGE
HGVRALGSILDLSQKGLAVASVALLLLVLLARSRLPLLTSASSKQ
Reference
  Authors
Niehaus TD, Okada S, Devarenne TP, Watt DS, Sviripa V, Chappell J
  Title
Identification of unique mechanisms for triterpene biosynthesis in Botryococcus braunii.
  Journal
Proc Natl Acad Sci U S A 108:12260-5 (2011)
DOI:10.1073/pnas.1106222108

DBGET integrated database retrieval system