KEGG   Addendum: AFB74619
Entry
AFB74619          CDS       T10000                                 
Symbol
SDR1
Name
(KEGG) noscapine synthase
  KO
K22098  noscapine synthase [EC:1.1.1.415]
Taxonomy
TAX:3469
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Papaveraceae; Papaveroideae; Papaver
Organism
Papaver somniferum
SSDB
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_4 GDP_Man_Dehyd NAD_binding_10 NmrA adh_short Polysacc_synt_2 KR
Other DBs
NCBI-ProteinID: AFB74619
GB: JQ659007
UniProt: I3PLR3
LinkDB
AA seq 348 aa
MHGQKNISERYQKFKEMEGTGKIVCVTGGAGYLASWLIMRLLERGYSVRTTVRSDPKFRE
DVSHLKALPEATEKLQIFEADLENPESFDDAINGCVGVFLVAQGMNFAEEYTLEKIIKTC
VEGTLRILQSCLKSKTVKKVVYTSSADAAMMISNLKAVKEIDETIWSEVDNFISKPEQVI
PGLPSYVVSKVLTERACLKFSEEHGLDVVTILPPLVVGPFITPHPPPSVSIALSIISGDV
SMMLGVRLENAVHIDDVALAHIFVFECEKAKGRHICSSVDFPMHDLPKFISENYPEFNVP
TDLLKDIEEQEPVHLSSDKLLSMGFQFKYDFAEIFGDAIRCAKEKGFL
Reference
  Authors
Winzer T, Gazda V, He Z, Kaminski F, Kern M, Larson TR, Li Y, Meade F, Teodor R, Vaistij FE, Walker C, Bowser TA, Graham IA
  Title
A Papaver somniferum 10-gene cluster for synthesis of the anticancer alkaloid noscapine.
  Journal
Science 336:1704-8 (2012)
DOI:10.1126/science.1220757

DBGET integrated database retrieval system