KEGG   Addendum: AFO10115
Entry
AFO10115          CDS       T10000                                 

Symbol
tmuM
Name
(KEGG) 1,3,7-trimethyluric acid 5-monooxygenase (EC:1.14.13.212)
  KO
K00492  1,3,7-trimethyluric acid 5-monooxygenase [EC:1.14.13.212]
Taxonomy
TAX:765715
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas sp. CBB1)
SSDB
Motif
Pfam: FAD_binding_3 FAD_binding_2 Pyr_redox NAD_binding_8 Pyr_redox_2 DAO Lycopene_cycl HI0933_like Trp_halogenase AlaDh_PNT_C SE Pyr_redox_3 FAD_oxidored GIDA ApbA Thi4 3HCDH_N
Other DBs
NCBI-ProteinID: AFO10115
GB: JQ743481
UniProt: I7ASS7
LinkDB
AA seq 396 aa
MSRPLRVTIIGAGIGGLSAAVALRKIGADVTVVERAPELRAAGAGICMWPNGAQALHALG
IANPLEMVSPILHRVCYRDQHGRVIREMSIDKLTELVGQRPFPLARSDLQAALLSRLDPA
LVRLGGACVSVEQDANGVRAVLDDGTEIASDLLVGADGIRSVVRNHVTGGTDRLRYHYTT
WLGLVSFGLNLTPPGTFTFHVQDSKRVGLLNVGDDRLYFFFDAVPSGEANPDGVRAELRH
HFDGWCSEVTTLVEALDEAKTNRLPVHDLDPLASFVNGRIVLIGDAAHATTPTLGQGGAL
AMEDSLVLARHLAESTDYGSALASYDNERLMRTRQVVLASRARTAATLGIDNTSAQTWQK
QLTDDASQDFLEQLVDIHRAGPLAAWPHDRQEGVAT
Reference
  Authors
Mohanty SK, Yu CL, Das S, Louie TM, Gakhar L, Subramanian M
  Title
Delineation of the caffeine C-8 oxidation pathway in Pseudomonas sp. strain CBB1 via characterization of a new trimethyluric acid monooxygenase and genes involved in trimethyluric acid metabolism.
  Journal
J Bacteriol 194:3872-82 (2012)
DOI:10.1128/JB.00597-12

DBGET integrated database retrieval system