KEGG   Addendum: AHK60834
Entry
AHK60834          CDS       T10000                                 
Symbol
CYP72A224
Name
(KEGG) 7-deoxyloganate 7-hydroxylase (EC:1.14.14.85)
  KO
K23276  7-deoxyloganate 7-hydroxylase [EC:1.14.14.85]
Taxonomy
TAX:4058
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Organism
ag  Addendum (Catharanthus roseus)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AHK60834
GB: KF302067
UniProt: U5NE19
LinkDB
AA seq 521 aa
MELNFKSIIFLVFVSLTLYWVYRILDWVWFKPKKLEKCLREQGFKGNPYRLFLGDQYDSG
KLIRQALTKPIGVEEDVKKRIVPHILKTVGTHGKKSFMWVGRIPRVNITDPELIKEVLTK
YYKFQKNHHDLDPITKLLLTGIGSLEGDPWAKRRKIINAAFHFEKLKLMLPAFYLSCRDM
VTKWDNKVPEGGSAEVDVWHDIETLTGDVISRTLFGSNFEEGRRIFELMKELTALTIDVI
RSVYIPGQRFLPTKRNNRMRAIDKEVRVRITEIINKKMKVMKSGEAASAADDFLGILLEC
NLNEIKEQGNNKSAGMTIGEIIGECKLFYFAGQDTTSTLLVWTMVLLSRFPEWQTRAREE
VFQVFGNKTPDYDGISHLKVITMILYEVLRLYTPVAELTKVAHEATQLGKYFIPAGVQLM
MPQILLHHDPEIWGEDVMEFKPERFAEGVLKATKSQGSFFPFSLGPRMCIGQNFALLEAK
MAMSLILRRFSFELSPSYVHAPFTLITMQPQYGAHLILHKL
Reference
  Authors
Miettinen K, Dong L, Navrot N, Schneider T, Burlat V, Pollier J, Woittiez L, van der Krol S, Lugan R, Ilc T, Verpoorte R, Oksman-Caldentey KM, Martinoia E, Bouwmeester H, Goossens A, Memelink J, Werck-Reichhart D
  Title
The seco-iridoid pathway from Catharanthus roseus.
  Journal
Nat Commun 5:3606 (2014)
DOI:10.1038/ncomms4606

DBGET integrated database retrieval system