KEGG   Addendum: BAA25268
Entry
BAA25268          CDS       T10000                                 
Symbol
hexs-b
Name
(KEGG) hexaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific] (EC:2.5.1.83)
  KO
K21275  hexaprenyl-diphosphate synthase large subunit [EC:2.5.1.83]
Taxonomy
TAX:1270
  Lineage
Bacteria; Actinomycetota; Micrococcales; Micrococcaceae; Micrococcus
Organism
Micrococcus luteus
SSDB
Motif
Pfam: polyprenyl_synt SeqA_N DUF4313
Other DBs
NCBI-ProteinID: BAA25268
GB: AB003188
UniProt: O66129
Structure
LinkDB
AA seq 325 aa
MIALSYKAFLNPYIIEVEKRLYECIQSDSETINKAAHHILSSGGKRVRPMFVLLSGFLND
TQKDDLIRTAVSLELVHMASLVHDDYIDNSDMRRGNTSVHIAFDKDTAIRTGHFLLARAL
QNIATINNSKFHQIFSKTILEVCFGEFDQMADRFNYPVSFTAYLRRINRKTAILIEASCH
LGALSSQLDEQSTYHIKQFGHCIGMSYQIIDDILDYTSDEATLGKPVGSDIRNGHITYPL
MAAIANLKEQDDDKLEAVVKHLTSTSDDEVYQYIVSQVKQYGIEPAELLSRKYGDKAKYH
LSQLQDSNIKDYLEEIHEKMLKRVY
Reference
PMID:9515931
  Authors
Shimizu N, Koyama T, Ogura K
  Title
Molecular cloning, expression, and characterization of the genes encoding the two essential protein components of Micrococcus luteus B-P 26 hexaprenyl diphosphate synthase.
  Journal
J Bacteriol 180:1578-81 (1998)
DOI:10.1128/JB.180.6.1578-1581.1998
Reference
  Authors
Nagaki M, Kimura K, Kimura H, Maki Y, Goto E, Nishino T, Koyama T
  Title
Artificial substrates of medium-chain elongating enzymes, hexaprenyl- and heptaprenyl diphosphate synthases.
  Journal
Bioorg Med Chem Lett 11:2157-9 (2001)
DOI:10.1016/S0960-894X(01)00391-2

DBGET integrated database retrieval system