KEGG   Addendum: BAD91803
Entry
BAD91803          CDS       T10000                                 
Symbol
CDOPA5GT
Name
(KEGG) cyclo-DOPA 5-O-glucosyltransferase
  KO
K15776  cyclo-DOPA 5-O-glucosyltransferase [EC:2.4.1.-]
Taxonomy
TAX:3538
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Nyctaginaceae; Mirabilis
Organism
Mirabilis jalapa
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-ProteinID: BAD91803
GB: AB182643
UniProt: Q59J81
LinkDB
AA seq 500 aa
MTAIKMNTNGEGETQHILMIPFMAQGHLRPFLELAMFLYKRSHVIITLLTTPLNAGFLRH
LLHHHSYSSSGIRIVELPFNSTNHGLPPGIENTDKLTLPLVVSLFHSTISLDPHLRDYIS
RHFSPARPPLCVIHDVFLGWVDQVAKDVGSTGVVFTTGGAYGTSAYVSIWNDLPHQNYSD
DQEFPLPGFPENHKFRRSQLHRFLRYADGSDDWSKYFQPQLRQSMKSFGWLCNSVEEIET
LGFSILRNYTKLPIWGIGPLIASPVQHSSSDNNSTGAEFVQWLSLKEPDSVLYISFGSQN
TISPTQMMELAAGLESSEKPFLWVIRAPFGFDINEEMRPEWLPEGFEERMKVKKQGKLVY
KLGPQLEILNHESIGGFLTHCGWNSILESLREGVPMLGWPLAAEQAYNLKYLEDEMGVAV
ELARGLEGEISKEKVKRIVEMILERNEGSKGWEMKNRAVEMGKKLKDAVNEEKELKGSSV
KAIDDFLDAVMQAKLEPSLQ
Reference
  Authors
Sasaki N, Wada K, Koda T, Kasahara K, Adachi T, Ozeki Y
  Title
Isolation and characterization of cDNAs encoding an enzyme with glucosyltransferase activity for cyclo-DOPA from four o'clocks and feather cockscombs.
  Journal
Plant Cell Physiol 46:666-70 (2005)
DOI:10.1093/pcp/pci064

DBGET integrated database retrieval system