KEGG   Addendum: BAI70375
Entry
BAI70375          CDS       T10000                                 
Symbol
dcsA
Name
(KEGG) Nomega-hydroxy-L-arginine synthase
  KO
K19741  Nomega-hydroxy-L-arginine synthase [EC:1.14.-.-]
Taxonomy
TAX:1914
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces lavendulae)
Module
1914_M00785  Cycloserine biosynthesis, arginine/serine => cycloserine
SSDB
Motif
Pfam: YqcI_YcgG
Other DBs
NCBI-ProteinID: BAI70375
GB: AB516431
UniProt: D2Z024
LinkDB
AA seq 265 aa
MNCYPAGHLLGKGHVQLNESGENAELISQEQIGDDLNGWHRDAFEDIASRLTDPGFPCVF
SRNAFRKKLVKFVFVEGSGKEDIRHLGAGLKDYVELSRDWDGALDTAYPLVVVFSADAVT
ADSVEQYHAFGWWVLQELHAIDPTPWPEGVDKGPQSEAWSMCFHGMPLFINMSSPAHQVR
RSRNLGRHFALVINPRERFDVFAGDTPSGRKVRSNIRGRIARYDGTPHAQQLGSYGTGAL
EWMQYGLVEENRERADVCPFTFRGA
Reference
  Authors
Kumagai T, Koyama Y, Oda K, Noda M, Matoba Y, Sugiyama M
  Title
Molecular cloning and heterologous expression of a biosynthetic gene cluster for the antitubercular agent D-cycloserine produced by Streptomyces lavendulae.
  Journal
Antimicrob Agents Chemother 54:1132-9 (2010)
DOI:10.1128/AAC.01226-09
Reference
  Authors
Kumagai T, Takagi K, Koyama Y, Matoba Y, Oda K, Noda M, Sugiyama M
  Title
Heme protein and hydroxyarginase necessary for biosynthesis of D-cycloserine.
  Journal
Antimicrob Agents Chemother 56:3682-9 (2012)
DOI:10.1128/AAC.00614-12

DBGET integrated database retrieval system