KEGG   Addendum: BAK20464
Entry
BAK20464          CDS       T10000                                 
Symbol
CYP82N2v2
Name
(KEGG) protopine 6-hydroxylase (EC:1.14.14.98)
  KO
K21693  protopine 6-monooxygenase [EC:1.14.14.98]
Taxonomy
TAX:3467
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Papaveraceae; Eschscholzioideae; Eschscholzia
Organism
ag  Addendum (Eschscholzia californica)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: BAK20464
GB: AB598834
UniProt: F2Z9C1
LinkDB
AA seq 524 aa
MDSLMLAYLFPISVASIIAFVFLYNLFSSRTLKNKKIRTAPMATGAWPVLGHLHLFGSGE
LPHKMLAAMADKYGSAFRMKFGKHTTLVVSDTRIVKECFTTNDTLFSNRPSTKAFQLMTY
DNESVAFTPYGSYWREIRKISTLKLLSNHRLQAIKDVRASEVNVCFKTLYDQCKNPSGSA
PILIDMKKWFEEVSNNVVMRVIVGRQNFGSKIVQGEEEAIHYKKVMDELLRLASLSMFSD
FAPLLGFVDIFQGNLSAMKRNAKKVDAILENWLEEHRKKKNSVAESQQDFMDVMLSIVEE
SKLSGHDADAVIKATCLAMIMGGTDTTAVSLTWIISLLMNNRHALKKAREELDALVGKDR
QVEDSDLKNLVYMNAIVKETMRMYPLGTLLERETKEDCEIDGFHVKGGTRLLVNVWKLQR
DPNVWVDPTEFRPERFLTENADIDVGGQHFELLPFGAGRRVCPGVXFALQFMHLVLARLI
HGYDLNTLNEENVDLTESPEGHVNHKASPLDLILTPRLHYKLYE
Reference
  Authors
Takemura T, Ikezawa N, Iwasa K, Sato F
  Title
Molecular cloning and characterization of a cytochrome P450 in sanguinarine biosynthesis from Eschscholzia californica cells.
  Journal
Phytochemistry 91:100-8 (2013)
DOI:10.1016/j.phytochem.2012.02.013

DBGET integrated database retrieval system