KEGG   Addendum: CAA63161
Entry
CAA63161          CDS       T10000                                 
Symbol
pur6
Name
(KEGG) puromycin biosynthesis protein Pur6
  KO
K12631  puromycin biosynthesis protein Pur6
Taxonomy
TAX:132473
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces aurantiacus group
Organism
ag  Addendum (Streptomyces alboniger)
Module
132473_M00889  Puromycin biosynthesis, ATP => puromycin
SSDB
Other DBs
NCBI-ProteinID: CAA63161
GB: X92429
UniProt: Q53740
LinkDB
AA seq 772 aa
MTLSITLTRTPGEYLAAALDRPATAPAAVPVLDPTGRHVWPRRIAARLGLPLTTAHDPDR
PAGPAAAAGDATRDEDVLLGAALTELRTGREEHLVVAVAHGDDHAFAHPAAVYALAKRAR
LLSAANEDDIHRTVRDTAPRFLTLVGPARLLDFGLVTRIRARFPALDVGVLYAHSAAKLS
ELVLKTLVYPEAPATADVLIAPLLKGDEPLRNGQLTVYPQDAVDAATFTRPAPRPGVATA
EPRDPAEPAPMHRLFSVITHGSEDYLRLTSQDILCGLTPDPAEQAAARRESRTLPACMHG
GDCVYPDARRWDPAGIPAQIVFANACLTLKLGTQLFGSHNRFTVAQRFLDSWAGTYIASP
LLKDGTPGENLLFHYLLDEGATVGGAVRQVNDSLRRWGVDAPEVLVIGDPEARYAPAAAR
PVPDAVTCQEEPGRAEITFEGRLPAFTRVPLKDPDLREAHRGGQLRLVPAKPFGGKLPLY
GTFGETADGEPAALVFGFQERRLSGTETSRTLTAAPRQRTAADRIVRAVERYENLAALDI
KLDKTRSVLTDTANSLPAVARRTKDHIADLTQSEPLHRATERILANCARLDRHLLDTLLR
LTETREYHFVEAYRPTYAVEEVRSPYGECRYCGEATHRYTSAHVLRPWLCRLLISCPVCG
ATQDTEDATVGIAIEGDAVLAPDSTTSLRARITNDGDQELDLLLGARITRGKPHGFRFAL
SPDRLTVPAGGTATSHLTITTGRPTSLHAMLLRFYAVGLGRIDFAGRDLRFR
Reference
PMID:8576156
  Authors
Tercero JA, Espinosa JC, Lacalle RA, Jimenez A.
  Title
The biosynthetic pathway of the aminonucleoside antibiotic puromycin, as deduced from the molecular analysis of the pur cluster of Streptomyces alboniger.
  Journal
J Biol Chem 271:1579-90 (1996)
DOI:10.1074/jbc.271.3.1579

DBGET integrated database retrieval system