KEGG   Addendum: CAA74912
Entry
CAA74912          CDS       T10000                                 

Gene name
TEM-17
Definition
(KEGG) beta-lactamase class A TEM-17
  KO
K18698  beta-lactamase class A TEM [EC:3.5.2.6]
Taxonomy
TAX:1018
  Lineage
Bacteria; Bacteroidetes; Flavobacteriia; Flavobacteriales; Flavobacteriaceae; Capnocytophaga
Organism
ag  Addendum (Capnocytophaga ochracea)
SSDB
Motif
Pfam: Beta-lactamase2 Beta-lactamase Peptidase_S11
Other DBs
NCBI-ProteinID: CAA74912
GB: Y14574
UniProt: O32372
LinkDB
AA seq 286 aa
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP
EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVREL
CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Reference
  Authors
Rosenau A, Cattier B, Gousset N, Harriau P, Philippon A, Quentin R
  Title
Capnocytophaga ochracea: characterization of a plasmid-encoded extended-spectrum TEM-17 beta-lactamase in the phylum Flavobacter-bacteroides.
  Journal
Antimicrob Agents Chemother 44:760-2 (2000)
DOI:10.1128/AAC.44.3.760-762.2000

DBGET integrated database retrieval system