KEGG   Addendum: CAA78264
Entry
CAA78264          CDS       T10000                                 
Symbol
TPR
Name
(KEGG) trypanothione-disulfide reductase (EC:1.8.1.12)
  KO
K04283  trypanothione-disulfide reductase [EC:1.8.1.12]
Taxonomy
TAX:5656
  Lineage
Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina; Trypanosomatida; Trypanosomatidae; Leishmaniinae; Crithidia
Organism
Crithidia fasciculata
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 HI0933_like NAD_binding_9 GIDA FAD_oxidored
Other DBs
NCBI-ProteinID: CAA78264
GB: Z12618
UniProt: P39040
Structure
LinkDB
AA seq 491 aa
MSRAYDLVVIGAGSGGLEAGWNAASLHKKRVAVIDLQKHHGPPHYAALGGTCVNVGCVPK
KLMVTGANYMDTIRESAGFGWELDRESVRPNWKALIAAKNKAVSGINDSYEGMFADTEGL
TFHQGFGALQDNHTVLVRESADPNSAVLETLDTEYILLATGSWPQHLGIEGDDLCITSNE
AFYLDEAPKRALCVGGGYISIEFAGIFNAYKARGGQVDLAYRGDMILRGFDSELRKQLTE
QLRANGINVRTHENPAKVTKNADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLDKAG
VEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRATDHT
KVACAVFSIPPMGVCGYVEEDAAKKYDQVAVYESSFTPLMHNISGSTYKKFMVRIVTNHA
DGEVLGVHMLGDSSPEIIQSVAICLKMGAKISDFYNTIGVHPTSAEELCSMRTPAYFYQK
GKRVEKIDSNL
Reference
PMID:3718941
  Authors
Shames SL, Fairlamb AH, Cerami A, Walsh CT
  Title
Purification and characterization of trypanothione reductase from Crithidia fasciculata, a newly discovered member of the family of disulfide-containing flavoprotein reductases.
  Journal
Biochemistry 25:3519-26 (1986)
DOI:10.1021/bi00360a007
Reference
PMID:1453951
  Authors
Aboagye-Kwarteng T, Smith K, Fairlamb AH
  Title
Molecular characterization of the trypanothione reductase gene from Crithidia fasciculata and Trypanosoma brucei: comparison with other flavoprotein disulphide oxidoreductases with respect to substrate specificity and catalytic mechanism.
  Journal
Mol Microbiol 6:3089-99 (1992)
DOI:10.1111/j.1365-2958.1992.tb01766.x

DBGET integrated database retrieval system