KEGG   Addendum: CAH55641
Entry
CAH55641          CDS       T10000                                 
Symbol
pigM
Name
(KEGG) 4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Taxonomy
TAX:616
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Yersiniaceae; Serratia
Organism
Serratia sp.
SSDB
Motif
Pfam: TM1586_NiRdase Nitroreductase
Other DBs
NCBI-ProteinID: CAH55641
GB: AJ833001
UniProt: Q5W259
LinkDB
AA seq 359 aa
MVNDTFEQALQNAINIARLAPSSHNCQPWSVHYDAATRCGEVSIDRQRALKGLPSLEREM
LMSCGIFFEYLSTLLKHSGYPLDWQWVGARQNGSSGMLISFAPSAPCVADLVAYQQWVQR
ISDRHTVRTAYQPTQVNEQQQAQLYALFDRSPVTCDIKYGEATRHDVAFLTANYASLDFA
DQQAWRETYHYIRFNEQQAAEDGFYLHHLFGPVSCGFRWFFRIAFHPRLSWLAKRLRLPA
SMAKGLAELVVEGPQYLALSLEHESDENLFIAGMKLGQLWLMLQSWGWSLHPLSVLVQHA
TARCALADTVRLTGLPVFFARFGQHRQSGIPTPRRAWQRILTTTQHSFSPENGADVKQP
Reference
  Authors
Harris AK, Williamson NR, Slater H, Cox A, Abbasi S, Foulds I, Simonsen HT, Leeper FJ, Salmond GP
  Title
The Serratia gene cluster encoding biosynthesis of the red antibiotic, prodigiosin, shows species- and strain-dependent genome context variation.
  Journal
Microbiology 150:3547-60 (2004)
DOI:10.1099/mic.0.27222-0

DBGET integrated database retrieval system