KEGG   Addendum: CCA65703
Entry
CCA65703          CDS       T10000                                 
Symbol
auaEII
Name
(KEGG) anthranilate-CoA ligase
  KO
K09460  anthranilate-CoA ligase [EC:6.2.1.32]
Taxonomy
TAX:41
  Lineage
Bacteria; Proteobacteria; Deltaproteobacteria; Myxococcales; Cystobacterineae; Archangiaceae; Stigmatella
Organism
ag  Addendum (Stigmatella aurantiaca)
Module
41_M00848  Aurachin biosynthesis, anthranilate => aurachin A
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: CCA65703
GB: AM404078
UniProt: F3Y661
Structure
LinkDB
AA seq 516 aa
MKASDLPLYYNAVDILERNLPVRANKTALFTPDREMTFRQVSNEANQVGNALKGLGVRFG
ECVGLLTLDSAEWVTSFFGIVKLGAIAVGINTLLKPPEYEYILRDCRARVLIVHQEFLPL
IESIRGNLPMLEHIVVIGEGPQEGYLSFNDWIRPQPTTLEAAQSHREDICSLNYSSGTTG
GPKGIPHAHKDYPLTAQLWGVNVLGLRESDRTFALAKLFFTFGTGGNLIFPWYVGASCVL
FPGAARVASNVLSTISRFKPTIFYNAPTGYAAALALKDFSQHDLSSLRLCVSASEALPAA
LWYAWKEATGVDIIDGIGCTENFHIFISNRPGDIRPGSSGKPVEGYELKLVDDEGKTVPA
GEIGNVLLRSETAALSYWHNFEKSRQTFQGEWLATGDKYFVDADGYYWHAGRSDDMLKVG
GIWVSPVEVESTLIQHPAVQECAVIGCPDQSRLIKPKAFIILKPEQIPSEALIRQITDHC
TEKMAAYKRPRWIEFVTELPKTATGKIQRFKLRSAA
Comment
Unpublished sequence data: Sandmann A (2011).
Reference
  Authors
Pistorius D, Li Y, Mann S, Muller R
  Title
Unprecedented anthranilate priming involving two enzymes of the acyl adenylating superfamily in aurachin biosynthesis.
  Journal
J Am Chem Soc 133:12362-5 (2011)
DOI:10.1021/ja203653w

DBGET integrated database retrieval system