KEGG   Addendum: P0C214
Entry
P0C214            CDS       T10000                                 
Symbol
p30II
Name
(KEGG) HTLV-1 accessory protein p30II
  KO
K23068  HTLV-1 accessory protein p30II
Taxonomy
TAX:194440
  Lineage
Viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Ortervirales; Retroviridae; Orthoretrovirinae; Deltaretrovirus
Organism
ag  Addendum (Primate T-lymphotropic virus 1)
SSDB
Motif
Pfam: Deltaretro_Tax
Other DBs
NCBI-ProteinID: P0C214
GB: J02029
LinkDB
AA seq 241 aa
MALCCFAFSAPCLHLRSRRSCSSCFLLATSAAFFSARLLRRAFSSSFLFKYSAVCFSSSF
SRSFFRFLFSSARRCRSRCVSPRGGAFSPGGPRRSRPRLSSSKDSKPSSTASSSSLSFNS
SSKDNSPSTNSSTSRSSGHDTGKHRNSPADTKLTMLIISPLPRVWTESSFRIPSLRVWRL
CTRRLVPHLWGTMFGPPTSSRPTGHLSRASDHLGPHRWTRYRLSSTVPYPSTPLLPHPEN
L
Reference
PMID:6304725
  Authors
Seiki M, Hattori S, Hirayama Y, Yoshida M
  Title
Human adult T-cell leukemia virus: complete nucleotide sequence of the provirus genome integrated in leukemia cell DNA.
  Journal
Proc Natl Acad Sci U S A 80:3618-22 (1983)
DOI:10.1073/pnas.80.12.3618
Reference
PMID:8445734
  Authors
Koralnik IJ, Fullen J, Franchini G
  Title
The p12I, p13II, and p30II proteins encoded by human T-cell leukemia/lymphotropic virus type I open reading frames I and II are localized in three different cellular compartments.
  Journal
J Virol 67:2360-6 (1993)
DOI:10.1128/JVI.67.4.2360-2366.1993

DBGET integrated database retrieval system