KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP004665
Entry
AgaP_AGAP004665   CDS       T01036                                 
Name
(RefSeq) AGAP004665-PA
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    AgaP_AGAP004665
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:aga00199]
    AgaP_AGAP004665
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     AgaP_AGAP004665
Cytochrome P450 [BR:aga00199]
 Cytochrome P450, animal type
  CYP306 family
   AgaP_AGAP004665
SSDB
Motif
Pfam: p450 DUF22
Other DBs
NCBI-GeneID: 1278717
NCBI-ProteinID: XP_318345
VectorBase: AGAP004665
UniProt: Q7Q2D4
LinkDB
Position
2R
AA seq 505 aa
MIMLMCLVILLLFCCIFITLLSRHKKPPGPYGFPFIGCLTLIDPLKPYETFSRLARQYGT
TYGLWMGQVYTVVLTDPTLIRTILSKDEATGRAPLFITHGIMGGHGIICAQGNLWRDQRR
LSIDWLRKLGMVKYGCARLNLERRINSGLIEMLQDIDNMVDKAPQGLNPSPIIHHVLGNL
LNDLVFGIKYEKNNVTWKYLQHLQEEGVKHIGVSMAVNFLPFLRYLPSTRRTINFLLSGK
HQTHAIYDALISHQRSKLRSCDTFIEEQEECILTYFLKEAAKRQEAGRPDAAFCDDIQLR
HLMADLFGAGVDTTFTTIRWALLYIALYPTVQKRLREELRQRLVVNEPPSLKDVEALPYL
RATIAEVQRIRTVVPLGIPHGTTKEIKIGDFKIPSNTMIMPVVWAVHMNPILFNAPNTFK
PERFLDLEGRFSIPNYFLPFQVGKRMCLGEELARNILHLYIANIVSHYDWIRISPEDAML
IDLTGNCGLTLTPPDYIIIFSKNNK
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgataatgctgatgtgtttagtaattttgttattgttttgctgtatcttcataactttg
ttgagccgacacaaaaagcctccgggaccatatggttttccattcattggatgcttaaca
ttaattgaccctcttaaaccatacgaaactttttctcgacttgcacgacaatatggtact
acatacgggttgtggatgggacaagtttatactgtagtactaactgatcctaccttaatt
cgaaccattttgtcaaaggatgaagccaccggtcgagcacccttgtttattacacacggt
ataatgggaggtcatggaatcatttgcgctcaaggcaatttatggcgcgatcaacgccga
ttatcaatcgattggcttcgtaaattgggaatggttaagtatggatgtgctcgattaaat
cttgaacggagaattaattctggacttatcgaaatgcttcaggacattgataatatggta
gataaggcaccacaaggtttaaacccatctcctatcatacatcacgtgctcggaaattta
ttaaatgatttagtttttggtataaaatacgaaaagaacaatgttacatggaaatattta
cagcaccttcaagaagaaggtgtgaagcatattggagtatctatggctgtgaacttctta
ccatttttgagatatttaccttctactcgtagaacaatcaattttcttctcagtggaaaa
catcaaacacatgctatttatgatgctttgatatcccatcaacgaagcaagttgcgttct
tgtgatacatttattgaagagcaggaggagtgcatattaacatattttttaaaagaagcc
gcaaaacgacaagaagcaggtcgaccggatgctgcattttgcgatgacatacagctacgc
catttgatggcagacttgttcggggcaggtgtggatactacatttactacgattcgatgg
gctttgctatatatcgccctatatccaactgttcaaaagcgtcttcgagaagaactgaga
caaagactggtcgtgaatgagccaccttcgttgaaagatgtggaggctttgccctattta
cgggcaaccatcgcggaagtgcagcgaattcgtaccgttgttccgcttggtatacctcat
ggaacaactaaggaaataaagattggtgattttaaaattccatcaaatacaatgatcatg
cctgtagtatgggctgtgcacatgaatcctatactattcaacgcgccaaacactttcaag
ccagaacggttcctggatttagaggggcgcttctccattccaaactactttcttccattt
caagtcggtaaacgtatgtgtttgggcgaagagcttgctagaaatattcttcatttgtac
atcgccaatatagtgtctcattacgattggattcggatatctcctgaggatgctatgttg
attgatttaacaggaaattgtggattaaccttaactcccccagactatataattatattc
tcgaaaaataataaataa

DBGET integrated database retrieval system