Aphidius gifuensis: 122858231 Help Entry 122858231         CDS       T07796                                  Name (RefSeq) GTPase HRas-like   KO K07827   GTPase KRas Organism agif  Aphidius gifuensis Pathway agif04013   MAPK signaling pathway - fly agif04068   FoxO signaling pathway agif04137   Mitophagy - animal agif04140   Autophagy - animal agif04150   mTOR signaling pathway agif04213   Longevity regulating pathway - multiple species agif04214   Apoptosis - fly agif04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:agif00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     122858231    04068 FoxO signaling pathway     122858231    04150 mTOR signaling pathway     122858231  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122858231    04137 Mitophagy - animal     122858231   09143 Cell growth and death    04214 Apoptosis - fly     122858231  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     122858231   09149 Aging    04213 Longevity regulating pathway - multiple species     122858231  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:agif04131]     122858231   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:agif04031]     122858231 Membrane trafficking [BR:agif04131]  Endocytosis   Macropinocytosis    Ras GTPases     122858231 GTP-binding proteins [BR:agif04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     122858231 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase AAA_28 G-alpha AAA_16 AAA_24 Gtr1_RagA Motif Other DBs NCBI-GeneID:  122858231 NCBI-ProteinID:  XP_044016926 LinkDB All DBs Position LG5:complement(18666166..18667009) Genome browser AA seq 186 aa AA seqDB search MQEYKLVIVGAASVGKSSLVIQFTHHHFIEMYDPTIEDSYKKQVVIDGETCTLDILDTAG QEEYSAMRDQYMRTGEGFLLVFALNLEESFYEIETFINQIRRVKDRDNVPMVLVGNKSDL QKPWDVDIIKAKELACQYGFPFFVTSAKTRCGVEDAFHNLVREIRKEKVKNCPNNRRSLR KRCSIL NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgcaagaatataaactagttattgttggagctgcatctgttggtaaatcttcattggta atacaatttacacaccatcattttatagagatgtatgatccaacgatagaagattcatac aagaaacaggttgttatagatggagaaacatgtacgttggatattttagatacagctggc caagaagagtacagtgcaatgagagatcagtacatgagaactggtgaaggatttttatta gtttttgcattaaatttggaagaaagtttttatgaaattgaaacgttcattaatcaaata agaagagttaaagatagagataatgtaccaatggtattagttggtaacaagtctgattta caaaaaccatgggatgtggatattataaaagcaaaagaacttgcatgtcaatatggtttt ccattttttgtaacatcagctaaaacacgatgtggtgttgaagatgcatttcacaatttg gtgagagaaatacgaaaagaaaaagtcaaaaattgtccaaataatcgtagatcactccga aaacgatgttcaattctttaa

DBGET integrated database retrieval system