KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGR229W
Entry
AGOS_AGR229W      CDS       T00167                                 
Name
(RefSeq) AGR229Wp
  KO
K12575  kinetochore protein SLK19
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago04111  Cell cycle - yeast
ago04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ago00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    AGOS_AGR229W
   04113 Meiosis - yeast
    AGOS_AGR229W
SSDB
Motif
Pfam: Fungal_TACC ATG16 TPR_MLP1_2 AAA_13
Other DBs
NCBI-GeneID: 4623197
NCBI-ProteinID: NP_986895
UniProt: Q74ZH8
LinkDB
Position
VII:1495038..1497155
AA seq 705 aa
MSTSRRESPVGMTGPADGSGVRINDARLTLAHSPVRGPAEDENGTADGSPAPKRLKMAAI
PRLGQPGGGGLISSPQPIEMVNAEPLALTSPVKRAEDQDRVDRQDVLDIQDDLKAGAAGT
PEKEGAYEKMTPVRPRAEARNLRAELEQQGSEGWDGVAALLEDKNRLIGSLTEEVRRVQD
ELWRQTQAREQLQVAACRAAERVRGLEAAEREQRALAAAYDELLGKKEKLEARAEKLKAR
MAELRNELTVAVQNAQILQEKYHEQIGANEELEQQLRDRAEDAQATASRLEAVEAELASL
REELAAGSQKLAAAEQGLEDAREKQREAEGSADALREQLTEKQQTIDELRAAVEQYKDAQ
SRSSSELDAKVAELTEENALIEREYQKLLKDYDTETKQLGGQMQQLSQEAEAWKAKYETD
CANLQALHNQHTETSKRAEQLTAELEEASNDLVSKKAEVAELSSLVEDLRQSEKYLQESI
TRREDSLKEWQEKLEAKEDELNRLHAEYDSVVFKNGNMEAEHLVELEQLHENMAKFQTML
ENLSVENAELKEKLAQTPQPDTKPPATPQFKQEQATPRKEDATPAQRTPAPAEPDPKPEH
ASPALPDPQPALAARVRELEAQLLEKDKDTTSRLQMLAEDLYVQYSSKHEQKVKMLKKSY
EVKYQESMNKLHLENSALLEEVSQLQAKLEVERREKQELIKLLDK
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgtcgacgtcgaggagagagtcgcctgtgggcatgacagggcccgcagatggcagtggg
gtgcggatcaacgacgcgcggctaacgctggcgcactcgccagtgcgcgggccagcagag
gatgagaacgggacggcggacgggagccccgcgccaaagcggctgaagatggcggcgatt
ccgcggctggggcagccaggcgggggcgggctgatctcgtcgccgcagccgatcgagatg
gtgaacgcggagccgctggcgctgacgagcccggtgaagcgggccgaggaccaggaccgg
gtggacaggcaggacgtgctagacatccaggacgacctcaaggcgggggctgcggggacg
ccggagaaggagggcgcgtacgagaagatgacgccggtgcggccgcgcgcggaggcgcgc
aacctccgagcagagctggagcagcagggcagcgagggctgggacggggtggcagcgctg
ctggaggataagaaccggctgatcgggtcgctgacggaggaggtgcggcgcgtgcaagac
gagctgtggcggcagacgcaggcgcgggaacagctgcaggtggcggcgtgccgcgcggcg
gagcgcgtgcgcgggttggaggcggcggagcgcgagcagcgcgcattggcagcagcgtac
gatgagctgctgggcaagaaggagaagctggaggcgcgcgcggagaagctgaaggcgcgc
atggcggagctgcgcaacgagctgacggtcgcggtgcagaacgcgcagatactgcaggag
aagtaccacgagcagatcggcgcgaacgaggagctcgagcagcagttgcgggaccgcgcg
gaggacgcgcaggcgaccgcttcacggctggaggcggtggaggcggagctggcgtccctg
cgcgaagagctcgcggcaggctcccagaagctggctgcggcagagcagggcctggaggac
gcgcgcgagaagcagcgcgaagccgaggggagcgcggacgcgctgcgcgagcagctcacg
gagaagcagcagacgatcgacgagctacgcgccgcggtcgagcaatataaggatgcgcag
tcgcgctcgtcgtcggagctggacgcgaaggttgccgagctgacggaggagaacgcgctc
atcgagcgtgagtaccagaagctactgaaggattatgatacagagaccaagcaattgggc
ggccaaatgcagcagctctcacaagaggccgaggcctggaaggcaaagtacgaaaccgac
tgtgctaacctgcaggcgcttcacaaccagcatacggagacgtcgaagcgtgccgagcag
ttaaccgccgagctggaggaggccagcaacgacctcgtcagcaaaaaggcagaggtcgcc
gagctctcctccctcgtggaggacctgaggcagtccgagaagtacctgcaggaatcgatc
acgcgacgcgaggactccctaaaggaatggcaggagaagctggaggccaaggaggacgag
ctaaacaggctccacgcagagtacgacagtgtcgttttcaaaaacggcaacatggaggcc
gagcacctcgtcgagctggagcagctgcacgagaacatggccaagttccagaccatgctt
gagaacctcagcgtggagaacgccgaactcaaggaaaagctcgcccagacgccccagccc
gacaccaagccacccgcgacgccccagttcaagcaggaacaggccacgcccaggaaggag
gacgcgacccccgcgcagcgcacaccggctcccgccgagccggaccccaaacccgagcac
gccagcccggcgttgccggacccccagcccgccctggcggcccgcgtccgtgagctcgag
gcccagcttctggaaaaagacaaagacactaccagccgcctccagatgctcgccgaggac
ctgtatgtccagtactcctcgaagcacgagcagaaagtcaagatgctgaagaagagctac
gaggtcaagtaccaggagtccatgaacaagctccacctcgagaattccgccctcctagag
gaggtctcccagcttcaggctaaactggaggtcgagcgccgcgagaagcaagaactcatc
aagctgctagataagtag

DBGET integrated database retrieval system