KEGG   Actinomadura graeca: AGRA3207_005105
Entry
AGRA3207_005105   CDS       T07938                                 
Name
(GenBank) FAD-dependent monooxygenase
  KO
K14256  anhydrotetracycline 6-monooxygenase / 5a,11a-dehydrotetracycline 5-monooxygenase [EC:1.14.13.38 1.14.13.234]
Organism
agra  Actinomadura graeca
Pathway
agra00253  Tetracycline biosynthesis
agra01057  Biosynthesis of type II polyketide products
agra01100  Metabolic pathways
agra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:agra00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    AGRA3207_005105
   00253 Tetracycline biosynthesis
    AGRA3207_005105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:agra01008]
    AGRA3207_005105
Enzymes [BR:agra01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.38  anhydrotetracycline 6-monooxygenase
     AGRA3207_005105
    1.14.13.234  5a,11a-dehydrotetracycline 5-monooxygenase
     AGRA3207_005105
Polyketide biosynthesis proteins [BR:agra01008]
 Polyketide tailoring proteins
  Oxygenase
   AGRA3207_005105
SSDB
Motif
Pfam: FAD_binding_3 Pyr_redox DAO Pyr_redox_2 HI0933_like Pyr_redox_3 NAD_binding_8 Lycopene_cycl
Other DBs
NCBI-ProteinID: QXJ23887
UniProt: A0A8F5BEK0
LinkDB
Position
5752112..5753605
AA seq 497 aa
MEDRVVIAGGGPAGLMLACELGLLGVDAVVLERDPEPDENSQGMAVHGRSLEVFKQRGLA
DRIRKEDIWAWPRTPFAFFWLDLDGVGEEDHTYAFPQWRTERLLEDRARELGVDIRRGHE
LVGFEQDATGVTVETRSAAGPDRLRGAFLVGCDGADSRVRRLAGIEFETAGLGYHGVLGD
VVLSDGPPPEFTTGLFQQGMFGALPLQPGELRLMTIEFGAEGPGPGTPVTAEELRASIRR
VTGTDPEVEGVRWLARFGGTTRHARRYREGRVLLAGDAAHVLYISGTQGLNAGIQDAVNL
GWKLAAEIQGRAPDGLLDTYHGERHPVGERICSHARAQMALMHPFDRVTPLRGLVAELLE
IGAVNRFLLELPSATGYPLPVAEGTEGEPHPLLGRPVPDVPLDTGGGPAGTAEALHAGRG
VLLDLSGGAADLGEAAAWAGRVDIVTAKPVPELDAAVLLVRPDGHVAYADRTGGDGKGLR
WALATWFGEPAPAGAAG
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggaagacagggtcgtcatcgccggcgggggaccggccggtctcatgctggcgtgcgag
ctcgggttgctgggagtggacgccgtcgtcctcgaacgggacccggagccggacgagaac
tcgcaggggatggccgtccacgggcgttccctggaggtgttcaagcagcgcggcttggcc
gaccgcatccggaaggaggacatctgggcctggccccgcactccgttcgccttcttctgg
ctcgacctcgatggcgtgggcgaggaggaccacacctacgcctttccccagtggcggacg
gaacggctcctggaggaccgcgcccgcgagctgggggtggacatccgccggggccacgag
ctggtgggcttcgaacaggacgccaccggggtcaccgtcgagacccgctccgccgcgggc
ccggaccgactccggggcgccttcctggtgggctgcgacggcgcggacagcagggtccgg
cgactcgccgggatcgagttcgagacggccggcctcggttaccacggcgtcctcggcgac
gtcgtcctctcggatggcccgccgcccgagttcacgaccgggctgttccagcagggcatg
ttcggggcgctgccgctccagcccggcgagctgcggctgatgaccatcgagttcggcgcg
gagggcccgggccccggaacgcccgtcaccgcggaggaactgcgcgcgagcatccgccgg
gtgaccggcaccgaccccgaggtcgagggtgtgcggtggctggcgcggttcggcggcacc
acccgtcacgcccggcggtacagggagggacgggtgctgctggccggggacgccgcccac
gtcctctacatctccggcacgcagggcctgaacgccggcatccaggacgcggtcaacctc
ggctggaagctggccgccgagatccagggccgggccccggacggcctcctcgacacctac
cacggggagcggcacccggtcggtgagcggatctgctcgcacgcgcgggcgcagatggcc
ctgatgcatccgttcgaccgggtcacgccgctgcgcgggctcgtcgcggagctgctggag
atcggcgcggtcaaccggttcctgctggagctgccgtccgcgacgggctatcccctgccc
gtcgcggagggcaccgagggggagccgcaccccctgctcggacggcccgtcccggacgtg
ccgctggacaccggcggggggcccgccggcaccgccgaggccctgcacgccggccggggg
gtgctgctggacctgtccggcggcgccgccgatctcggcgaggccgccgcctgggccggg
cgggtcgacatcgtcaccgcgaagcccgtgccggagctggacgccgcggtgctgctggtg
cggccggacggccacgtggcctacgccgaccgcacgggcggcgacggcaagggcctccgc
tgggccctcgccacctggttcggtgaacccgcccccgccggcgcggccggatga

DBGET integrated database retrieval system