KEGG   Aphis gossypii (cotton aphid): 114132491
Entry
114132491         CDS       T05869                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:ags00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    114132491
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ags00199]
    114132491
Enzymes [BR:ags01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     114132491
Cytochrome P450 [BR:ags00199]
 Cytochrome P450, animal type
  CYP306 family
   114132491
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 114132491
NCBI-ProteinID: XP_027853758
LinkDB
Position
Unknown
AA seq 492 aa
MFWIIGVILFGALYAGYLWRSNKNLPPGPWGVPILGYLPWLDPERPYKTLTALAYKYGPI
YSIQMGKHFAVVMSEPTLVRMALARNELADRTNFEVINEIMQEHGLIFTRGPLWKEQRKF
VCNWLKVIGVSKFGEKKNNLQLLIADAVSTTISKLRESNTCPIDTGTFFLVQIGDFINLI
VLGKAWPEDDPNWVYLRNLAEDGSKKFAIATPLSVLPMLKIIPKYKNTVFEVIEGVKNTH
CIYKTLMEKRGNEINENDDLMAMFMKEMIKRTNNKDSHFFTEKQCCFLLSDLFGAGVETS
VNTLRWFLLYMALNKEIQNELQTLLDSVCTNGGIIDLEQIENIPLLKACVSETMRLRPVA
PSGIPRSVNNEITLEGYRIPKGTMVLPLQWAMHHDEKYWTDPLTFQPKRFLDDEGNMINN
KAFMPFQAGKRACVGDTLSYWILYLFGANIIHNFNVSMEDGLSEKEINTIMDGEFGITLS
PATHNIVFKSRI
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgttttggatcattggtgtaatattatttggtgcgttgtatgctggatatctatggcgt
tccaacaaaaacttacccccaggtccttggggtgttccaattctcggttatcttccgtgg
ctagatcctgaaagaccttacaaaactttgacggccctggcttataagtatggaccgatt
tacagtattcaaatgggaaaacattttgcagtcgttatgtcggagccgacactagttaga
atggcattagcacggaacgaactggcagaccgcactaactttgaagttatcaacgaaatc
atgcaagaacatggtctgatatttacacgcggacctctttggaaagaacagcgaaaattt
gtttgcaattggcttaaggtaattggcgtgtcgaagttcggggagaagaaaaataactta
caactacttattgccgacgccgtgtctactacaatatcgaaattacgagagtcaaataca
tgtcccattgatacaggaacgttttttctagtacaaataggagatttcataaatctcata
gtgttgggtaaagcttggccagaagatgaccctaattgggtttatttacgaaatttagct
gaagatggatccaaaaaatttgctatagctactccattgagtgttttaccaatgttgaag
ataatacctaagtacaaaaatactgtttttgaagtaatcgagggagttaaaaatacgcat
tgcatttacaaaacattgatggagaaacgaggcaatgaaatcaatgaaaatgacgatcta
atggccatgttcatgaaagaaatgataaaaagaacaaacaacaaagattcccatttcttc
actgaaaaacaatgttgttttcttctgtctgatctttttggtgctggtgtagaaacttcc
gtgaatactctaagatggtttcttctatacatggctttaaataaagaaatacagaatgaa
ttacagacattattggattctgtgtgcacaaatggcgggataatagacttagagcaaatt
gaaaacattccattgctaaaagcttgtgtatctgaaacgatgcgattacggccggtagct
ccatctggaatacctcgatcggtcaacaacgaaattacacttgagggataccgcatacca
aaagggaccatggttttaccactgcagtgggcaatgcaccacgacgaaaaatattggacg
gaccctctaacatttcaaccgaaaagatttttagacgacgagggaaatatgataaacaac
aaagcatttatgccatttcaagccggtaaaagagcttgtgttggagatacgctttcctat
tggatactctatttattcggtgcaaatataattcataatttcaatgtttccatggaagac
ggtttatctgaaaaagaaattaacaccatcatggacggggagtttggcataacgctcagt
ccggctacgcacaacatcgtttttaaatctcgaatttag

DBGET integrated database retrieval system