KEGG   Anaerobacillus isosaccharinicus: AWH56_015605
Entry
AWH56_015605      CDS       T06884                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
aia  Anaerobacillus isosaccharinicus
Brite
KEGG Orthology (KO) [BR:aia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aia03000]
    AWH56_015605
Transcription factors [BR:aia03000]
 Prokaryotic type
  Other transcription factors
   Others
    AWH56_015605
SSDB
Motif
Pfam: Bmp DUF4364
Other DBs
NCBI-ProteinID: QOY34154
UniProt: A0A1S2L777
LinkDB
Position
3079827..3080783
AA seq 318 aa
MNVIRISFSVFLFVFMVGCSTVTETGNLTKVGLLLPHNIDDQGWNSKGYEGLLKIHSSLN
VDVFYKEEINSREKAELAIAEFVDSGVNLIFGHSQIFATYFMELKDEYPNIHFITFNADV
DGDNITSLHFEGYSMGFFAGMLASEMSETNTVGVLAAFPWQPEVEGFIEGVLFQNSNVDV
KVEFVSSWVDIEKALDLYKQMVGEGVDVFYPAGDGYHVAIIEEVKKHGLYVIGFVGDHSD
LGQSTVLTSTIQHVDFLYELVVDKFIKGELDSGNKYYDFAEGVITLGNYSPEVPEEIQEK
INNAINTYIETGKLPNQF
NT seq 957 nt   +upstreamnt  +downstreamnt
atgaatgtcattcgcatcagtttttcagtattcttatttgtttttatggtaggatgttca
acggttactgaaacaggcaacctaacaaaggttggtctattactaccccataatattgat
gatcaaggttggaacagcaaaggttatgaaggtttattgaaaattcattcaagcttaaat
gtagatgttttttataaggaagaaattaattcaagggaaaaagctgaattagctatagct
gaatttgttgattctggtgtaaatctaatttttggacatagtcaaatatttgcgacatat
tttatggaattaaaggatgaatacccaaatattcattttataacctttaatgcggatgta
gatggcgataacattacgagcttacattttgaaggttattcaatgggtttttttgctggg
atgttagcaagtgagatgtcagaaacgaatacagttggagtattagcggcgtttccttgg
cagccagaagttgaagggtttatcgaaggggtactttttcaaaacagcaacgttgacgta
aaagtagagtttgtatctagttgggttgatattgaaaaggcgctagacttatataaacaa
atggttggagaaggtgtagatgttttttatcctgcaggtgatgggtatcacgtagcaatt
atagaagaagttaagaagcatggtttatatgttattggttttgtaggggatcattctgat
ctaggacaatctactgtacttacaagtacgattcaacacgtcgattttctttatgagtta
gttgttgataaatttattaaaggggaactcgactctggcaataaatactatgactttgca
gagggagttataacgttaggtaactacagcccagaagttcctgaagaaattcaggaaaag
attaataatgcgataaatacatacattgaaactggtaaacttccaaatcaattttaa

DBGET integrated database retrieval system