KEGG   Artibeus jamaicensis (Jamaican fruit-eating bat): 119038034
Entry
119038034         CDS       T07223                                 
Name
(RefSeq) integrin alpha-X-like
  KO
K06462  integrin alpha X
Organism
ajm  Artibeus jamaicensis (Jamaican fruit-eating bat)
Pathway
ajm04610  Complement and coagulation cascades
ajm04810  Regulation of actin cytoskeleton
ajm05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ajm00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    119038034
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    119038034
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    119038034
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ajm04515]
    119038034
   04090 CD molecules [BR:ajm04090]
    119038034
Cell adhesion molecules [BR:ajm04515]
 Integrins
  Integrin alpha subunits
   119038034
CD molecules [BR:ajm04090]
 Proteins
  119038034
SSDB
Motif
Pfam: VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE
Other DBs
NCBI-GeneID: 119038034
NCBI-ProteinID: XP_036986336
LinkDB
Position
Unknown
AA seq 909 aa
MPDLPVMIRTRISLLLLMVVASSLCFNLDTDTPTTFLMDSAGFGHTVVQYANSWVVVGAP
QEIKAINQTGGLYQCAYSTATCQSIDLEVPLEAVNMSLGLSLTAATNPSQLLACGPTVHH
ACKENMYLTGSCFLLAFPSWKAQRLPASLQECPRQEQDIVFLIDGSGSISSRDFVKMLSF
VKAVMSQFQRPSTQFSLMQFSNKFQIHFTFKDFMYTSDPLSLLNSVHQLRGFTHTASAIR
MVINELFSAPSGARKDASKILIVITDGQKEGDPLGYKNVIPMAEAAGIIRYAVGVGSAFQ
KQHSWKELNDIASRPSNDYIFKVENFDALRDIQNKLKEKIFAIEGTQTTSSSTFELEMSQ
EGFSAVFTPDGPVLGAVGSFSWSGGAFVYRPNVSPTFINMSQENVDMRDSYLGYSTELAL
WKGVQSLVLGAPRHQHTGKVNIFTQVSGKWKPKAEVTGTQIGSYFGASLCSVDVDRDGNS
DLVLIGAPHYYELTQGGQVSVCPLPRGRARWQCEVILRGEQGHPWGRFGAALTVLGDVNG
DRLTDVAIGAPGEQENQGAVYLFHGTSGLGISPSHSQVRPHCRPHHYHHLLLASPALPHC
HLENSLLSHLTSFARHWCLPLPQITFIATFDVSPKAMLGDRLLLMANVSSENNTPRTSKT
AFQLELPVKYAVYTVISSHEKSTKYLNFSASEEKGSSLAQHRYQVNNLGQRDLPVSISFL
VPVELNQVTVWTDLKILHPQNPSVQCPAEKMVPTESNFLTHIQKNHVLDCSIADCLRFRC
DIPSFGIQEELDFILMGNLSFSWVSQTLQKKVSVVSVAAITFNRSVYSQLPGQEAFLRAQ
MEMVLEKHDVHNPTLLIVGSSVGGLLLLALITATLYKLGFFKRQYKEMLDDKPEDTTTFS
GDAPNLPLS
NT seq 2730 nt   +upstreamnt  +downstreamnt
atgcctgacctcccagtcatgatcaggaccaggatatcccttcttctgttgatggtagtg
gcttcctctctctgcttcaacttggacacggacacaccaacaaccttcctcatggacagt
gctgggtttggacacactgtggtccagtatgccaactcctgggtggtagttggagccccc
caagaaataaaggccatcaaccaaacaggaggcctctaccagtgtgcctatagcacagct
acctgtcagtccatcgacctggaggtccccctagaagctgtgaacatgtccctgggctta
tccctgacagctgccaccaacccctctcagctgctggcctgtggccccactgtgcaccat
gcatgcaaggagaatatgtacttgaccgggtcctgctttctgttggccttcccttcctgg
aaggcccagaggctcccagcttccctgcaggagtgtccaaggcaggagcaggacatcgtc
tttctgattgatggctcaggcagcatttcttccagagattttgtcaagatgctgagcttc
gtgaaggctgtgatgagccaattccagagacccagcacccagttctccctgatgcagttc
tccaacaagttccagattcacttcactttcaaagacttcatgtacacctcagacccacta
agcctgttgaattctgtgcatcagttgagagggttcacgcacacagcctcagccatcagg
atggtcataaatgaactattcagtgccccaagtggggcccggaaggatgcctccaagatc
ctcattgtgatcactgatgggcagaaagaaggagaccccctgggttataagaatgtcatc
cctatggctgaggcagcaggcatcattcgctatgcagttggggtgggatcggcgtttcaa
aagcaacattcctggaaagaattaaacgacattgcatcaaggccctccaatgattatata
tttaaagtggagaactttgatgctttgagagacattcaaaacaaactaaaagagaagatc
tttgccattgagggtacacagacaacaagcagtagtaccttcgaattggagatgtcccag
gagggcttcagtgctgtgtttacacccgatggaccagttctgggggccgtggggagcttc
agctggtctggaggtgcctttgtgtaccgccctaatgtgagccccacattcatcaacatg
tctcaggagaatgtggacatgagggactcttacctgggttactccaccgagctggccctt
tggaagggggtgcagagcttggtcctgggggccccacgccatcagcacaccgggaaggtc
aacatctttacacaggtgtccggaaagtggaagccgaaggctgaagtcacagggacccag
attggctcctactttggggcctccctgtgctcagtggacgtggacagagatggcaactcc
gacttggtcctcatcggggctccccattactacgagctgacccagggggggcaggtgtct
gtgtgccccttgcccagggggagagctaggtggcagtgtgaggtcattctccgtggggag
cagggccacccctggggacgcttcggggcagccctgactgtgctgggggacgtgaatggg
gacaggctgacggatgtggccatcggggccccgggagaacaggagaaccagggtgctgtc
tacctgtttcatgggacctcaggactgggcatcagcccctcccacagccaggtgaggccc
cattgcagaccccatcactaccaccaccttctccttgcttctcctgctcttccacactgc
cacctagaaaattctctgttatcacatcttacctcctttgcccgccactggtgcctgcct
cttcctcagatcaccttcatagccacctttgacgtctcccccaaggccatgctgggagac
cgcctgcttctaatggccaatgtgagcagtgagaataacacccccaggaccagcaagact
gccttccagctggagctcccggtgaagtatgctgtctacaccgtgatcagcagccatgag
aaatccaccaagtatctcaacttctctgcctctgaggagaagggaagcagcctggcccag
cacagataccaggtaaacaacctgggacagagggacctgcctgtcagcatcagcttcttg
gtgcctgtggagctgaaccaggtgactgtgtggacagatttgaagatcctccacccccag
aacccatctgttcagtgtcctgctgagaaaatggtgcccacagagtccaacttcctcacc
cacattcagaagaatcatgtgctggactgctccattgctgactgcctgaggttccgctgt
gacatcccctcctttggcatccaggaggagctcgacttcatcctgatgggaaacctcagc
ttcagctgggtcagccagacgttgcagaagaaggtgtcagtcgtgagtgtggctgcaatc
acattcaacagatctgtgtattcccagcttccaggacaggaggcgtttttgagagcccag
atggagatggtgttggagaagcatgatgtccacaaccccacactcctcattgtgggcagc
tctgtgggagggctgctgctgctggctctcatcacagcaacactctacaagcttggcttc
ttcaaacgtcagtacaaagaaatgctggatgacaagcccgaagacaccaccacattcagt
ggggatgcccccaatttgcctttgtcctaa

DBGET integrated database retrieval system