KEGG   Artibeus jamaicensis (Jamaican fruit-eating bat): 119048697
Entry
119048697         CDS       T07223                                 

Name
(RefSeq) glutathionyl-hydroquinone reductase YqjG-like
  KO
K07393  glutathionyl-hydroquinone reductase [EC:1.8.5.7]
Organism
ajm  Artibeus jamaicensis (Jamaican fruit-eating bat)
Brite
KEGG Orthology (KO) [BR:ajm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    119048697
Enzymes [BR:ajm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.5  With a quinone or similar compound as acceptor
    1.8.5.7  glutathionyl-hydroquinone reductase
     119048697
SSDB
Motif
Pfam: GST_N_2 GST_C_2 GST_C_3 GST_C GST_N_3 GST_C_6 TPR_12
Other DBs
NCBI-GeneID: 119048697
NCBI-ProteinID: XP_037000273
LinkDB
Position
Unknown
AA seq 310 aa
DRTPSTFRSFVSRDASARFPAVAGRYHLYVSYACPWASRCLAYLKLKGLDHAISFSSVKP
IFERTRESDDHLGWVFPASAGEVPGADPDPFNGAKSVRDLYEIASTNYTGKPTVPVLWDK
QLKTVVNNESSEIIRMLNSEFNGIAENPGLDLNPAHLQASIDEVNGLVYDAINNGVYKCG
FAKKQGPYDEAVTTLYEALDKCEEILGKQRYMCGNQLTEADVRLFVTLIRFDEVYAVHFK
CNKKLLREYPNLFNYTKDMYQIPGISSTVNMEHIRKHYYGSHPSINPYGIIPQGPNVDYN
APHDRERLFL
NT seq 933 nt   +upstreamnt  +downstreamnt
gaccggacgccgtccaccttccggagcttcgtgtcgagggacgcctccgcccgcttcccc
gcggtggcgggcaggtaccacctctacgtctcctacgcctgcccctgggcgtcccgctgc
ctcgcctacctcaagctcaagggcctcgaccacgccatcagcttctcgtctgtgaagccc
atcttcgagcggaccagggagtccgacgaccacctggggtgggtgttcccggccagcgcc
ggcgaggtgcccggcgccgaccccgaccccttcaacggcgccaagagcgtcagggacctg
tacgagatcgcgagcaccaactacaccggcaaacccactgttcccgtgctgtgggacaag
cagctgaagacggtggtgaacaacgagagcagcgagatcatccgcatgctcaactcggag
ttcaacggcatcgccgagaaccccgggctggacctcaacccggcgcacctccaggcctcc
atcgacgaggtcaacggcctcgtctacgacgccatcaacaacggcgtctacaagtgcggc
ttcgccaagaagcaggggccatacgacgaggccgtcacgacgctgtacgaggctctggac
aagtgcgaggagatcctgggcaagcagcggtacatgtgcggcaaccagctcaccgaggcc
gacgtccgcctcttcgtcacgctcataagatttgacgaggtttacgccgttcacttcaag
tgcaacaagaagctgctgagggagtaccccaacctgttcaactacaccaaggacatgtac
cagatccccgggatcagcagcacggtgaacatggagcacatcaggaagcactactacggg
agccacccctccatcaacccctacgggatcatcccccaaggccccaacgtcgactacaat
gccccacatgacagggaaaggctgttcctgtaa

DBGET integrated database retrieval system