KEGG   Acinonyx jubatus (cheetah): 106966466
Entry
106966466         CDS       T04657                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04927  Cortisol synthesis and secretion
aju04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:aju00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    106966466 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106966466 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ RecA_dep_nuc EVC2_like
Other DBs
NCBI-GeneID: 106966466
NCBI-ProteinID: XP_026897523
UniProt: A0A6J1XYA8
LinkDB
Position
Unknown
AA seq 111 aa
MANQTNASTLYDSYEYYLDYVDLIPVDERKLKANKYLIVIAFWVSLAFFVMLLFLILLYM
SWSGSSQVRNNAQHHPTRPWSRGLNLPLCVWRHPTGSPGLGQGARQQSIPP
NT seq 336 nt   +upstreamnt  +downstreamnt
atggccaaccagaccaacgcctccaccctgtacgacagctacgaatactacttggactac
gtggacctcattcccgtggatgagaggaagctgaaagccaacaaatatctgattgtcatt
gccttctgggtgagcctggcatttttcgtcatgcttctcttcctcatcctgctctacatg
tcctggtcagggtcctcgcaggtgaggaacaacgcccagcaccacccaacacgcccctgg
agtcgcggcctcaacctcccgctctgcgtctggaggcaccccacaggctcccccgggctc
gggcaaggagccaggcagcagagcatcccgccctga

DBGET integrated database retrieval system