KEGG   Acinonyx jubatus (cheetah): 106970196
Entry
106970196         CDS       T04657                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A isoform X2
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00250  Alanine, aspartate and glutamate metabolism
aju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106970196 (RIMKLA)
Enzymes [BR:aju01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     106970196 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     106970196 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 Dala_Dala_lig_C ATP-grasp CPSase_L_D2 Synapsin_C TTL
Other DBs
NCBI-GeneID: 106970196
NCBI-ProteinID: XP_014922257
UniProt: A0A6I9ZMJ2
LinkDB
Position
Unknown
AA seq 349 aa
MKHLLERGGNYAGLQLNQKALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRP
QSILNCVNKFWTFQELAGHGVPMPDTFSYGGHDDFSKMIDEAEPLGYPVVVKSTRGHRGK
AVFLARDKHHLSDICHLIRHDVPYLFQKYVKESHGKDIRVVVVGGRVIGSMLRCSTDGRM
QSNCSLGGVGVMCPLTEQGKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLA
FDQACNLDVGGIIADYTMSLLPNRQTGKMAVLPGLSSPREKKEPDGCTSAQGVAESVYAI
NNGSTSSESEPELGEIRDSSVSTAGAPPPMLPEPGYNINNRIASELKLK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaacatcttctagaacgcgggggaaactatgcaggtcttcagctgaaccagaaggcg
cttaccactttcccagacgtggtgctcgtgcgggtgcccacaccctcagtgcagtcagac
agcgacatcaccgtcctgcgccacctggagaagctgggctgccgcctggtcaaccgccca
cagagcattttaaactgtgtcaacaagttctggactttccaagagctggctggacatggg
gttcctatgccagacaccttctcctatggtgggcatgatgacttttccaaaatgatcgat
gaggctgagcccctgggctacccggtcgtggtgaagagcacacgaggacaccggggaaaa
gctgtttttcttgcaagagataaacatcacctctcagacatctgccatctgatccgccat
gatgtgccctacctgttccagaagtatgtgaaggagtcacatggcaaagacatccgggtg
gtggtggtcgggggccgggtgataggctctatgctccgctgctccacagacggacggatg
caaagcaactgctctcttggcggtgtgggtgtcatgtgcccgctgacagaacaaggcaag
cagttggctattcaggtgtccaacatcctgggcatggacttctgtggcattgatctcctc
atcatggacgatggctcctttgtggtgtgtgaggcaaacgccaacgtcggcttcttagcc
ttcgaccaggcatgcaatttagatgtgggtggcatcatcgcggactataccatgtccttg
ctgcccaataggcagactggcaagatggctgtcctcccgggactgtccagtcccagggag
aagaaagagccagatggctgcacttcagctcagggagttgcagagagtgtctacgccatc
aacaatgggtctacctctagtgagagtgagcctgaactgggagagatccgggattcctca
gtgagcacagcgggggccccgccccccatgctgcctgaacctggctacaacattaacaac
aggattgcttcagaattaaaacttaagtga

DBGET integrated database retrieval system