KEGG   Acinonyx jubatus (cheetah): 106988165
Entry
106988165         CDS       T04657                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106988165 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:aju04050]
    106988165 (TNFRSF8)
   04090 CD molecules [BR:aju04090]
    106988165 (TNFRSF8)
Cytokine receptors [BR:aju04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   106988165 (TNFRSF8)
CD molecules [BR:aju04090]
 Proteins
  106988165 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 CoV_E
Other DBs
NCBI-GeneID: 106988165
NCBI-ProteinID: XP_026916184
UniProt: A0A6J1ZHQ2
LinkDB
Position
Unknown
AA seq 594 aa
MRPLRAVLGLLLLGVLGAFPQDRVPRDVYAGDPGHHHKTAGLPCPQGSPDCRKQCEPDYY
LNRDGRCTACVSCARDDLVEKMPCSGNSSRVCECRTGTFCATSATNSCARCIPHTVCPKG
MIVKVQGTAQMDTVCERPSPVTSPDLGTGPEDCQAPTSDTSAQAGPLVTSSVSSGARTTL
LGGDTAITPEDDSKMTGAPGSPSSVRKPSPDPGLTPQPPCPQGSPDCRKQCEPDYYLDRD
GHCMACVSCARDDLVEKTPCTWNSSRVCECQPGMFCVTPVTNSCAHCVTRPVCPPGMATK
PQGTAERDATHEPPPPLEAHPECSTNPEDSKAPTSATASPVSAADPQGSKEHGGGNTHTW
GDTFTSTSSPISFSSTGKPILVSGPVLFWMVMILVVVLVSISFLLCHWRACRKWIRQKLH
LCYPAQTFRPTLEPVDSRPRRNLTQLRSCISVAKPGTEELGLMGPPAVETCPNGEACLQS
MRLLDASPAGSPPSPRDLPEPRVTSEHTNNRIEKIYIMKADTVIVGTVRTEVPEGRGLAG
PTGPELEEDLEGDHAYPHFPEQETEPPLGSCGDVMFSVEEEGKEAPLPMTVSEK
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgcgccccctccgcgctgtgctgggactgctgctcctgggggtgctgggagccttcccg
caggatcgagttccgagggacgtctatgctggagaccctggccaccatcacaaaactgcc
gggctgccgtgcccccaggggtcacctgactgcaggaagcagtgtgagcccgactactac
ctgaacagggacggccgctgcacggcctgtgtgagctgtgctcgagacgatcttgtggag
aagatgccgtgctcagggaactcctcccgcgtctgtgagtgccgcactggcacgttctgt
gccacgtcagccaccaactcctgtgcccgctgcatcccccacaccgtctgcccgaaaggg
atgattgtcaaggtccagggcacagcacagatggatactgtgtgtgagcggccttccccg
gtgaccagccctgacctcggcacgggcccagaagactgccaggcgcccaccagcgacacc
agcgcccaggccgggcccctggtgacctcctcagtgagctccggtgccaggaccacgctc
cttggaggggacactgccatcacccccgaagatgattccaaaatgacgggggcccccggc
tctccctcctctgtgaggaagcccagtccagatccagggctgaccccgcagccgccgtgt
ccccaggggtcacctgactgtaggaagcagtgtgagcccgactactacctggacagggac
ggccactgcatggcctgtgtgagctgtgctcgagatgacctggtggagaagacaccctgt
acgtggaactcctctcgtgtctgcgaatgtcaacctggcatgttctgtgtcacaccagtc
accaactcctgtgcccactgtgtcacccgccccgtctgcccaccaggcatggccaccaaa
ccccagggtacagctgagagggatgccacccatgagccgccgcctcccctagaagcccac
cccgagtgcagcaccaacccagaggacagcaaggcgcccaccagcgccacggcctctccg
gtctctgcagcagacccccaaggcagtaaggagcatggagggggcaacacccacacctgg
ggagacaccttcacatcaacgagctcccctatctctttctcctccacgggaaagcccatt
ctggtttcaggacctgtgctcttctggatggtcatgatcctggtggtggtcttggtctcc
atctccttcctcctgtgccactggagggcctgcaggaagtggattcggcagaagctccac
ctgtgctaccctgcccagaccttccggcccacgctggagcctgtggattccaggcccagg
aggaacctgacccagttgaggagttgcatatcggtggccaagccgggcacagaggagctg
ggattaatgggccccccggccgtggagacctgccccaacggggaagcgtgcctgcagagc
atgcggctgctggatgccagcccggccgggagccccccgtcccccagggaccttcccgag
ccccgggtgacctcagagcataccaacaacaggatcgagaaaatctacatcatgaaggct
gacacagtgattgtggggaccgtgaggaccgaggtgcctgagggccggggcctggcgggg
ccgacggggcctgaattggaggaggatctggaaggggaccacgcgtacccccacttcccg
gagcaggagacagagccgcctctgggcagctgcggggacgtcatgttctcagtagaagag
gaaggaaaggaggcccccttgcccatgactgtctctgagaaatga

DBGET integrated database retrieval system