KEGG   Agrobacterium larrymoorei: CFBP5473_23905
Entry
CFBP5473_23905    CDS       T06268                                 
Name
(GenBank) D-nopaline dehydrogenase
  KO
K00296  D-nopaline dehydrogenase [EC:1.5.1.19]
Organism
alf  Agrobacterium larrymoorei
Pathway
alf00330  Arginine and proline metabolism
alf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CFBP5473_23905
Enzymes [BR:alf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.19  D-nopaline dehydrogenase
     CFBP5473_23905
SSDB
Motif
Pfam: Octopine_DH NAD_Gly3P_dh_N ApbA Rossmann-like
Other DBs
NCBI-ProteinID: QCJ01009
UniProt: A0A4D7DXJ5
LinkDB
Position
pTiCFBP5473:complement(203952..205112)
AA seq 386 aa
MDFSSSTCAPLSVLILGAGHVGTALAAWFTFRSIAVSLWAPLEHRGYLKDFSDACVRIRT
SGLLNGDYFVPVQESLASAVAKATLLIIATRADAHPDLVRRFQLIGESLSAKEVLVVCGR
GFAIKYAGALSFKRILETDNSPVTSKLTGDHLSVVQIKEFKKVFGASCYPIYLGENSRAC
LPSDVICMLNQLFPFSVKAILPLETALFSNYITHAVSAVLNIGRLPDDCKLSEKAKSWRR
NPEKGGNGFPYYFYGEGSNSVVCRVQEAVDRERLEIGRAYGIVLRPILAESNEEYGTDYP
SLREYCLAPSPHNVNFACPDSIQHRYYMEELSNIELIISLANAVGVRVPLTEGVALIIRS
AGGLGERTLTDLKAEDAVKFGGNCQK
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggatttctcctccagcacctgtgcacccctcagcgttttaattctaggtgccggtcac
gttggaaccgctctcgctgcttggttcaccttcagaagcatcgccgtctcactttgggca
ccccttgaacatcggggatatctaaaagatttctctgatgcgtgcgtgaggatcagaacg
agtgggctgttaaatggcgattacttcgttcctgtacaggaaagcttggcttcagcagtg
gcgaaagccacgttgctcataatcgccacccgagccgacgctcatccggacttggtcaga
cgctttcaattaataggggagagtttgtcagcgaaagaagttctagtggtctgcgggcga
ggcttcgccatcaaatacgctggcgctctctcattcaagagaatactagaaacggacaac
tctccggttacgtccaaactaacaggcgaccatttgtcagttgttcagatcaaagagttc
aaaaaggtatttggagcgtcgtgttatccaatatatttgggtgaaaattcacgagcatgc
cttccatctgatgtgatatgtatgctgaaccaacttttccctttcagcgtgaaagcgata
ctcccattggagactgcgctattttctaactacattacacatgccgtctcggctgtactt
aatattgggaggttgcccgacgattgtaagctttcagaaaaagctaagagttggcgccgc
aaccccgagaaaggcgggaacgggttcccctattatttttatggtgaaggcagcaattct
gtagtttgccgcgtacaggaggctgtcgacagagaacgtttagaaattgggcgcgcttat
ggaattgttcttcgaccaatcctcgctgaatcgaatgaagagtatggaacagattatccg
tctctgagggagtattgcctagctccctctccacacaacgtgaattttgcatgcccggac
agcatacagcatcgctattacatggaggagctttctaatatcgaattaatcatttcgcta
gcaaatgctgtcggtgtgcgcgttccgctgaccgagggcgttgctttgattatccgatct
gcgggtggcctcggagagcggacgctgacagatctgaaggcggaggatgctgtgaagttt
ggagggaattgccagaagtga

DBGET integrated database retrieval system